DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and YOR283W

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_014926.1 Gene:YOR283W SGDID:S000005809 Length:230 Species:Saccharomyces cerevisiae

Alignment Length:77 Identity:19/78 (24%)
Similarity:40/78 (51%) Gaps:8/78 (10%)


  Fly    71 NGEESSALRHIILVRHGE-------YTRTPNGSHLTELGRRQAERTGQRLREMGLSWDHVVASTM 128
            :.::::.:| :.::|||:       ..:....:.:...|..||.:.|..||..|:.:|.||:|.:
Yeast    10 DNDDNNIIR-LFIIRHGQTEHNVKKILQGHKDTSINPTGEEQATKLGHYLRSRGIHFDKVVSSDL 73

  Fly   129 PRAEETAMIILK 140
            .|..:|..::||
Yeast    74 KRCRQTTALVLK 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 18/69 (26%)
YOR283WNP_014926.1 His_Phos_1 19..214 CDD:306748 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2287
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.