DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and AT5G22620

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001154730.1 Gene:AT5G22620 AraportID:AT5G22620 Length:482 Species:Arabidopsis thaliana

Alignment Length:312 Identity:68/313 (22%)
Similarity:114/313 (36%) Gaps:92/313 (29%)


  Fly     4 TALWRSVGAMSCGSLVTYFAIRLFDGLEP------------SMLSGGAQGGKGRAIEPLASGAWR 56
            |..:||:...:||..|..|..|. ||..|            |.|:||:.||:             
plant   212 TEYFRSLLQSNCGVSVLDFIPRA-DGGSPHVCLNRLNQTPNSPLAGGSSGGR------------- 262

  Fly    57 HHWDLDKPQLQKVANGEESSALRHIILVRHGEYTR---------TPNGSHLTELGRRQAERTGQR 112
                               .|.:.||||.||:...         ..|...:..||...:::|.:.
plant   263 -------------------KASKQIILVCHGQGNNEDSAVINQAANNDQAMNMLGVIHSQKTAEL 308

  Fly   113 LREMGLSWDHVVASTMPRAEETAMIILKQ------LNLDP----LKMKRCTLLPEGTPYPGDPPS 167
            |.::.:|  .:|.|....:.|::.:|.:.      |.:|.    :|.|:...|        |..|
plant   309 LLDLRVS--SIVCSPKTASIESSGVISRVQEAAGCLGVDNVPHYVKTKQMNEL--------DVES 363

  Fly   168 --KRSARSLD-LAYQRDGP-------RIEAAFRRYFFRASPEQEH-DSYLLIVGHSNVIRYLILR 221
              ::|.:..| :|.|.|..       |.|.|:.......|.|:.: ...:::||.:.....||.:
plant   364 VLRKSNKDNDVIASQLDEEAFSALWNRSEKAWESLLDELSDEKSNPGEIMVVVGPAMTHISLIAQ 428

  Fly   222 ALQLPPAAWTRLNLNHGSITWLTV--WPSGYVTLRCLGDSGFM-----PVTE 266
            .|.|...|....:|:.|||:.:..  .||....:||...:..:     |:|:
plant   429 CLNLTKEALGLFHLDAGSISVIDFPDGPSSKGVIRCTNYTAHLGRWSIPITK 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 44/195 (23%)
AT5G22620NP_001154730.1 His_Phos_1 50..241 CDD:278716 11/30 (37%)
PhoE 264..471 CDD:223483 49/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112626at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.