DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and AT5G04120

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_196032.1 Gene:AT5G04120 AraportID:AT5G04120 Length:238 Species:Arabidopsis thaliana

Alignment Length:209 Identity:52/210 (25%)
Similarity:81/210 (39%) Gaps:55/210 (26%)


  Fly    57 HHWDLDKPQLQKVANGEESSALRHIILVRHGEYTRTPNG-------SHLTELGRRQ----AERTG 110
            |.|...:.:.:...:.:..|.:..|:||||||.|....|       |.|.|:|.:|    |||.|
plant     3 HEWIDAEREFKWSEDVKVESEVTEIVLVRHGETTWNAAGRIQGQIESDLNEVGLKQAVAIAERLG 67

  Fly   111 QRLREMGLSWDHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYPGDPPSKRSARSLD 175
            :..|.:.     |.:|.:.||::||::|          .|.| ..||....|  ...:|...||.
plant    68 KEERPVA-----VYSSDLKRAKDTALMI----------AKTC-FCPEVIEVP--DLKERHVGSLQ 114

  Fly   176 LAYQRDGPRIEAAFRRYFFRASPEQE----HDSY----------------------LLIVGHSNV 214
            ..|.::|...|......||.:..:.|    .:|:                      :::|.|..|
plant   115 GLYWKEGAEKEPEAYSAFFSSQNDLEIPGGGESFDQLADRSMDALEQIAKKHKGERVIVVTHGGV 179

  Fly   215 IRYLILRALQLPPA 228
            :|.:.||..|...|
plant   180 LRAIYLRITQASSA 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 49/187 (26%)
AT5G04120NP_196032.1 His_Phos_1 27..216 CDD:278716 49/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112626at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.