DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and AT3G50520

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_190621.1 Gene:AT3G50520 AraportID:AT3G50520 Length:230 Species:Arabidopsis thaliana

Alignment Length:224 Identity:58/225 (26%)
Similarity:92/225 (41%) Gaps:62/225 (28%)


  Fly    81 IILVRHGEYT----RTPNGS---HLTELGRRQAERTGQRL-REMGLSWDHVVASTMPRAEETAMI 137
            |::|||||.:    |...|.   .|.:.||:||:|..:|| :|..:|  ||.:|.:.||.|||.|
plant    16 IVVVRHGETSWNAERKIQGHLDVELNDAGRQQAQRVAERLSKEQKIS--HVYSSDLKRAFETAQI 78

  Fly   138 I--------------LKQLNLDPLK----MKRCTLLPEG----------TPYPGDPPSKRSARSL 174
            |              |::.:|..::    .:...:.||.          ...||      ...||
plant    79 IAAKCGKLEVLTDRDLRERHLGDMQGLVYQEASKIRPEAYKAFSSNRTDVDIPG------GGESL 137

  Fly   175 DLAYQRDGPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGS 239
            |..|.    |...|.:|...:...|:     :::|.|..|||.|..||   .|:|.....:.:.|
plant   138 DKLYD----RCTTALQRIGDKHKGER-----IVVVTHGGVIRSLYERA---RPSARKVEKILNTS 190

  Fly   240 ITWLTVWPSGYVTLRCLGD------SGFM 262
            :....::.....|::..||      :||:
plant   191 VNVFRLFDGDKWTIQVWGDVSHLEETGFL 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 53/200 (27%)
AT3G50520NP_190621.1 His_Phos_1 16..207 CDD:278716 54/211 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112626at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129378
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.