DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and Pgam5

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001157010.1 Gene:Pgam5 MGIID:1919792 Length:288 Species:Mus musculus

Alignment Length:289 Identity:122/290 (42%)
Similarity:151/290 (52%) Gaps:47/290 (16%)


  Fly    14 SCGSLVTYFAIRLFDGLEPSMLSGGAQGGKGRAIEPLA-------SGAWRHHWDLDKP----QLQ 67
            :|| |....|..||..:......||..... ||.||.|       .|.|..:||..:|    .|:
Mouse    11 ACG-LAGGSAAVLFSAVAVGKPRGGGDADT-RATEPPAWTGARAGRGVWDTNWDRREPLSLINLK 73

  Fly    68 K--VANGEE----------SSALRHIILVRHGEY--------TRTPNGSHLTELGRRQAERTGQR 112
            |  |.:||:          :.|.|||.|:||.:|        .||     ||.|||.|||.||.|
Mouse    74 KRNVESGEDELTSRLDHYKAKATRHIFLIRHSQYHVDGSLEKDRT-----LTPLGREQAELTGLR 133

  Fly   113 LREMGLSWDHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYPGDPPS---KRSARSL 174
            |..:||.::.:|.|:|.||.||..||.|  :|..:......||.||.|...|||.   |..|   
Mouse   134 LASLGLKFNKIVHSSMTRAVETTDIISK--HLPGVSRVSTDLLREGAPIEPDPPVSHWKPEA--- 193

  Fly   175 DLAYQRDGPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGS 239
             :.|..||.|||||||.|..||...||.|||.:.:.|:|||||::.||||.||..|.||:||:||
Mouse   194 -VQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGS 257

  Fly   240 ITWLTVWPSGYVTLRCLGDSGFMPVTEIT 268
            ||.|.:.|:|.|.||.|||:||||..:||
Mouse   258 ITHLVIRPNGRVALRTLGDTGFMPPDKIT 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 83/176 (47%)
Pgam5NP_001157010.1 Interaction with KEAP1. {ECO:0000250} 76..81 2/5 (40%)
HP_PGM_like 98..271 CDD:132718 86/184 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152637882
eggNOG 1 0.900 E1_KOG4609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2287
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20935
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2720
TreeFam 1 0.960
98.790

Return to query results.
Submit another query.