powered by:
Protein Alignment: Pgam5-2 and TIGAR
Sequence 1: | NP_611911.1 |
Gene: | Pgam5-2 |
FlyBaseID: | FBgn0035004 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_065108.1 |
Gene: | TIGAR |
HGNCID: | 1185 |
Length: | 270 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 20/71 (28%) |
Similarity: | 32/71 (45%) |
Gaps: | 12/71 (17%) |
Fly 81 IILVRHGEYTRTPN---------GSHLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAM 136
:.:||||| ||... ...|:|.|.:||...|..|. .:.:.|..:|.:.|.::|..
Human 6 LTVVRHGE-TRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLN--NVKFTHAFSSDLMRTKQTMH 67
Fly 137 IILKQ 141
.||::
Human 68 GILER 72
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
|
|
|
D1112626at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.