DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and pgam5

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001007324.2 Gene:pgam5 ZFINID:ZDB-GENE-030131-683 Length:289 Species:Danio rerio

Alignment Length:261 Identity:120/262 (46%)
Similarity:148/262 (56%) Gaps:41/262 (16%)


  Fly    42 GKGRAIE--------------PLASGAWRHHWDLDKPQ-----LQKVANGEESS---------AL 78
            |:||.:.              |.|:| |.::||..:|.     .:|.:.||..|         |.
Zfish    34 GEGRRVTETLAAVNAAHPPAWPTANG-WDYNWDKREPSSMVNGKRKESTGENGSQDAENNKPRAT 97

  Fly    79 RHIILVRHGEYTRTPNGS---HLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAMIILK 140
            |||.|:||.:|....:|.   .||.|||.|||.|||||...||.:|.::.|:|.||.|||.||.|
Zfish    98 RHIFLIRHSQYNLKGDGDKERFLTPLGREQAEFTGQRLASFGLKYDTLIHSSMTRATETANIISK 162

  Fly   141 QLNLDPLKMKRCTLLPEGTPYPGDPPS---KRSARSLDLAYQRDGPRIEAAFRRYFFRASPEQEH 202
            .  |..:::..|.||.||.|....||.   |..|    :.|..||.|||||||||..||..:|:.
Zfish   163 Y--LPGVELVSCDLLREGAPIEPVPPVTHWKPEA----VQYHEDGARIEAAFRRYIHRADAKQKE 221

  Fly   203 DSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLTVWPSGYVTLRCLGDSGFMPVTEI 267
            |||.:||.|:|||||.:.||||.||..|.||.||:||||||||.|||.|:||.||||||||..::
Zfish   222 DSYEIIVCHANVIRYFVCRALQFPPEGWLRLGLNNGSITWLTVRPSGRVSLRALGDSGFMPPDKL 286

  Fly   268 T 268
            |
Zfish   287 T 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 88/171 (51%)
pgam5NP_001007324.2 HP_PGM_like 99..272 CDD:132718 93/179 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152641557
eggNOG 1 0.900 E1_KOG4609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112626at2759
OrthoFinder 1 1.000 FOG0005244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20935
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2720
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.