DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and pgam5

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_012814509.1 Gene:pgam5 XenbaseID:XB-GENE-948920 Length:279 Species:Xenopus tropicalis

Alignment Length:284 Identity:112/285 (39%)
Similarity:156/285 (55%) Gaps:54/285 (19%)


  Fly    30 LEPSMLSGGAQG------------GKGR--------AIEPLASGAWRHHWDLDKP---------- 64
            |..::::||:..            ||.:        ::.|.|:|.|..:||..:|          
 Frog     3 LRKALIAGGSAAAAAAALLGAVAVGKSKGGPDLDILSVVPAATGQWDRNWDRREPISMVNLSKIN 67

  Fly    65 ------QLQKVANGEESSALRHIILVRHGEYT---RTPNGSHLTELGRRQAERTGQRLREMGLSW 120
                  :||...|..:|.|.|||.|:||.:|.   :|.....||.|||.||:.||:||..:|..:
 Frog    68 GETGEEELQLHLNKHKSKATRHIFLIRHSQYKLDGKTDFDRVLTPLGREQADLTGKRLSSLGFKY 132

  Fly   121 DHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYPGDP------PSKRSARSLDLAYQ 179
            :|:|.|||.||:||..||.|.  |..:|.....||.||.|...:|      |.       .:.|.
 Frog   133 NHIVYSTMTRAKETTEIISKY--LPDVKKSSSDLLREGAPIRPEPQVCHWKPD-------FVQYY 188

  Fly   180 RDGPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLT 244
            .||.|||||||.:..||.|:||.|||.:::.|:|||||::.|||||||.||.|::||:|||::|.
 Frog   189 EDGSRIEAAFRHFIHRADPKQEADSYEILICHANVIRYIVCRALQLPPEAWLRMSLNNGSISYLV 253

  Fly   245 VWPSGYVTLRCLGDSGFMPVTEIT 268
            :.|:|.|:||.||||||||..:|:
 Frog   254 IRPNGNVSLRMLGDSGFMPPEKIS 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 80/174 (46%)
pgam5XP_012814509.1 HP_PGM_like 89..262 CDD:132718 83/182 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152640775
eggNOG 1 0.900 E1_KOG4609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1112626at2759
OrthoFinder 1 1.000 FOG0005244
OrthoInspector 1 1.000 T600600
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2720
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.