DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and CG7059

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651034.2 Gene:CG7059 FlyBaseID:FBgn0038957 Length:267 Species:Drosophila melanogaster

Alignment Length:84 Identity:25/85 (29%)
Similarity:41/85 (48%) Gaps:16/85 (19%)


  Fly    81 IILVRHGEYT-RTPN---GSH---LTELGRRQAERTG-QRLREMGLSWDHVVASTMPRAEETAMI 137
            ::::||||.. ...|   |.|   |:|.|.::|.... ..|.:..|.:|.|.:|.:.|:.:||.:
  Fly    21 LVILRHGESDFNIENKFCGWHDAPLSEFGVQEALTVAIPALVQSELEFDVVYSSVLSRSRQTAEL 85

  Fly   138 ILKQLNLDPLKMKRCTLLP 156
            ||.:||        |..:|
  Fly    86 ILSKLN--------CAYVP 96

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 25/85 (29%)
CG7059NP_651034.2 HP 19..266 CDD:299704 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129378
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.