DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and Tigar

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_795977.1 Gene:Tigar MGIID:2442752 Length:269 Species:Mus musculus

Alignment Length:236 Identity:54/237 (23%)
Similarity:80/237 (34%) Gaps:86/237 (36%)


  Fly    81 IILVRHGEYTRTPN---------GSHLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAM 136
            :.::|||| ||...         .:.|:|.|.|||...||.|  ..:.:.|..:|.:.|.::|..
Mouse     6 LTVIRHGE-TRLNKEKIIQGQGVDAPLSETGFRQAAAAGQFL--SNVQFTHAFSSDLTRTKQTIH 67

  Fly   137 IILKQ--------LNLDPLKMKRCTLLPEG--------------------TPYPGDPPSKRSARS 173
            .||::        :..|....:|...:.||                    ||..|:...:...|.
Mouse    68 GILEKSRFCKDMAVKYDSRLRERMYGVAEGKPLSELRAMAKAAGEECPMFTPPGGETVEQVKMRG 132

  Fly   174 LDL-----------AYQRD-------GPRIEAAFRRYFFRASPEQEHDSY--------------L 206
            .|.           |.||:       |..:|::....|    |..:|.|.              :
Mouse   133 KDFFDFICQLILGKAGQRESVLPGAPGSGLESSLAEVF----PVGKHGSLGANPKGGTLGLAASI 193

  Fly   207 LIVGHSNVIRYLI------LRALQLPPAAWTRLNLNHGSIT 241
            |:|.|...:|.|.      ||. .||.|   |..|...|||
Mouse   194 LVVSHGAYMRSLFGYFLSDLRC-SLPGA---RDKLELSSIT 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 54/237 (23%)
TigarNP_795977.1 His_Phos_1 6..241 CDD:278716 54/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.