DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and Pgam5

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_569951.1 Gene:Pgam5 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster

Alignment Length:295 Identity:131/296 (44%)
Similarity:173/296 (58%) Gaps:34/296 (11%)


  Fly     8 RSVGAMSCGS---LVTYFAIRLFDGLEPSMLSGGAQGGKGRAIEPLASGAWRHHWDLDKPQ--LQ 67
            |.:.:..||:   |..|:..||.|   |..:...:.....:.::|.|  .|..:||..:|:  ::
  Fly     2 RKLTSFVCGTGAGLAAYYLQRLRD---PQTVVQNSWTHSDKPVDPWA--LWDTNWDCREPRALVR 61

  Fly    68 KVANGE--------------ESSALRHIILVRHGEYTRTPNGS---HLTELGRRQAERTGQRLRE 115
            .:.|.:              ::...|||||||||||....:..   ||||.||:|||.||:||.|
  Fly    62 PLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDVGDSDDTHHLTERGRKQAEFTGKRLCE 126

  Fly   116 MGLSWDHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYPGDPPS---KRSARSLDLA 177
            :|:.||.||||||.||:||:.|||||::.:..|:..|..|.||.|.|..||.   |..|..    
  Fly   127 LGIKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQ---- 187

  Fly   178 YQRDGPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITW 242
            :.|||.||||.|||||.||.|:||.:||.|||||.|||||.:.||||.|...|.|:|:||.||||
  Fly   188 FLRDGSRIEAGFRRYFHRAYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHASITW 252

  Fly   243 LTVWPSGYVTLRCLGDSGFMPVTEITHRRPSPAKS 277
            ||:.|||.|:::.||||||||...:|:|.|...|:
  Fly   253 LTISPSGNVSIKYLGDSGFMPAELLTNRIPRDVKN 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 98/171 (57%)
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 102/181 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152636476
eggNOG 1 0.900 E1_KOG4609
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112626at2759
OrthoFinder 1 1.000 FOG0005244
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20935
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2720
65.970

Return to query results.
Submit another query.