DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5-2 and Bpgm

DIOPT Version :9

Sequence 1:NP_611911.1 Gene:Pgam5-2 / 37899 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_955414.1 Gene:Bpgm / 296973 RGDID:735018 Length:258 Species:Rattus norvegicus


Alignment Length:69 Identity:19/69 - (27%)
Similarity:33/69 - (47%) Gaps:7/69 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IILVRHGEYTRTPNG-------SHLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAMII 138
            :|::||||.......       ..|...|..:|...|::|:.:...:|.|..|.:.|:..||.:|
  Rat     6 LIILRHGEGQWNKENRFCSWVDQKLNSDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLI 70

  Fly   139 LKQL 142
            |::|
  Rat    71 LEEL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 19/69 (28%)
BpgmNP_955414.1 HP 4..253 CDD:416258 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.