DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and Pgam5

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001020443.1 Gene:Pgam5 RGDID:1312028 Length:288 Species:Rattus norvegicus

Alignment Length:282 Identity:122/283 (43%)
Similarity:151/283 (53%) Gaps:57/283 (20%)


  Fly    35 LSGGAQG--------GKGRA--------IEPLA-------SGAWRHHWDLDKP----QLQK--VA 70
            |:||:..        ||.||        .||||       .|.|..:||..:|    .|:|  |.
  Rat    14 LAGGSAAVLFSAVAVGKPRAGGDADTRTTEPLAWTGARPGHGVWDSNWDRREPLSLINLKKRNVE 78

  Fly    71 NGEE----------SSALRHIILVRHGEYTRTPNGS-----HLTELGRRQAERTGQRLREMGLSW 120
            .||:          :.|.|||.|:||.:|  ..:||     .||.|||.|||.||.||..:||.:
  Rat    79 FGEDELASRLDHYKAKATRHIFLIRHSQY--NVDGSMEKDRTLTPLGREQAELTGIRLASLGLKF 141

  Fly   121 DHVVASTMPRAEETAMIILKQLNLDPLKMKRCT-LLPEGTPYPGDPPS---KRSARSLDLAYQRD 181
            :.:|.|:|.||.||..||.|.|   |...:..| ||.||.|...|||.   |..|    :.|..|
  Rat   142 NKIVHSSMTRAVETTDIISKHL---PGVCRVSTDLLREGAPIEPDPPVSHWKPEA----VQYYED 199

  Fly   182 GPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLTVW 246
            |.|||||||.|..||..:||.|||.:.:.|:|||||::.||||.||..|.||:||:||||.|.:.
  Rat   200 GARIEAAFRNYIHRADAKQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIR 264

  Fly   247 PSGYVTLRCLGDSGFMPVTEIT 268
            |:|.|.||.|||:||||..:||
  Rat   265 PNGRVALRTLGDTGFMPPDKIT 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 85/174 (49%)
Pgam5NP_001020443.1 Interaction with KEAP1. {ECO:0000250} 76..81 2/5 (40%)
HP_PGM_like 98..271 CDD:132718 88/182 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152639690
eggNOG 1 0.900 E1_KOG4609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112626at2759
OrthoFinder 1 1.000 FOG0005244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20935
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.