DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and PGAM5

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001164014.1 Gene:PGAM5 HGNCID:28763 Length:289 Species:Homo sapiens

Alignment Length:266 Identity:116/267 (43%)
Similarity:144/267 (54%) Gaps:49/267 (18%)


  Fly    31 EPSMLSGGAQGGKGRAIEPLASGAWRHHWDLDKP------QLQKVANGEE----------SSALR 79
            ||...:|||:.|         .|.|..:||..:|      :.:.|.:|||          :.|.|
Human    43 EPPAWAGGARPG---------PGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATR 98

  Fly    80 HIILVRHGEY--------TRTPNGSHLTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAM 136
            ||.|:||.:|        .||     ||.|||.|||.||.||..:||.::.:|.|:|.||.||..
Human    99 HIFLIRHSQYHVDGSLEKDRT-----LTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTD 158

  Fly   137 IILKQLNLDPLKMKRCT-LLPEGTPYPGDPPS---KRSARSLDLAYQRDGPRIEAAFRRYFFRAS 197
            ||.:.|   |...|..| ||.||.|...|||.   |..|    :.|..||.|||||||.|..||.
Human   159 IISRHL---PGVCKVSTDLLREGAPIEPDPPVSHWKPEA----VQYYEDGARIEAAFRNYIHRAD 216

  Fly   198 PEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITWLTVWPSGYVTLRCLGDSGFM 262
            ..||.|||.:.:.|:|||||::.||||.||..|.||:||:||||.|.:.|:|.|.||.|||:|||
Human   217 ARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFM 281

  Fly   263 PVTEIT 268
            |..:||
Human   282 PPDKIT 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 85/177 (48%)
PGAM5NP_001164014.1 Interaction with KEAP1 77..82 2/5 (40%)
HP_PGM_like 99..272 CDD:132718 88/185 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152638447
eggNOG 1 0.900 E1_KOG4609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1112626at2759
OrthoFinder 1 1.000 FOG0005244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20935
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2720
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.