DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pgam5-2 and pgam-5

Sequence 1:NP_611911.1 Gene:Pgam5-2 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_495593.2 Gene:pgam-5 WormBaseID:WBGene00019941 Length:284 Species:Caenorhabditis elegans

Alignment Length:236 Identity:95/237 (40%)
Similarity:135/237 (57%) Gaps:17/237 (7%)


  Fly    48 EPLASGAWRHHWDL---------------DKPQLQKVANGEESSALRHIILVRHGEYTRTPNGSH 97
            |....|.|..:||.               |:...:|:...::::|.|:|.|:|||:|........
 Worm    49 EHFPRGEWDKNWDFRDPISLVDKGKWEKADEEGKKKLIEEKKATATRNIFLIRHGQYHLDHEVKM 113

  Fly    98 LTELGRRQAERTGQRLREMGLSWDHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYP 162
            ||.|||.|||..|:||....:.:.::..|||.||.|||.||||.|. |.|.......:.||.|||
 Worm   114 LTPLGREQAELLGKRLANSDIKFTNMTMSTMVRATETANIILKHLP-DDLTRTSSPFIEEGPPYP 177

  Fly   163 GDPPSKRSARSLDLAYQRDGPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPP 227
             ..|..::.|.||..:..:..|||:|:|:.|.||||.|:.||:.|||.|:|||||.|.||||.||
 Worm   178 -PVPDHKTWRPLDPEFYTEAARIESAYRKIFHRASPSQKEDSFELIVCHANVIRYFICRALQFPP 241

  Fly   228 AAWTRLNLNHGSITWLTVWPSGYVTLRCLGDSGFMPVTEIT 268
            ..|.|::|.:.|:||:|:.|.|:|::|.:||.|.:|..:|:
 Worm   242 EGWLRMSLGNCSLTWITIRPKGHVSVRSIGDIGHLPPNKIS 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 77/165 (47%)
pgam-5NP_495593.2 HP_PGM_like 96..270 CDD:132718 81/176 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C152636502
eggNOG 1 0.900 E1_KOG4609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2287
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1112626at2759
OrthoFinder 1 1.000 FOG0005244
OrthoInspector 1 1.000 T375113
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20935
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2720
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.