DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and SHP1

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_009495.1 Gene:SHP1 / 852222 SGDID:S000000154 Length:423 Species:Saccharomyces cerevisiae

Alignment Length:428 Identity:104/428 - (24%)
Similarity:159/428 - (37%) Gaps:111/428 - (25%)


  Fly     4 EQKLSTFMKRHGVREEVARQYLSSNNWSLEVASSTYESEAVSKK-----------QEPEKSSEHS 57
            ::.:..||....|...:|.||||......|..:|.|.|:...:|           ||.....|..
Yeast     6 DETIQQFMALTNVSHNIAVQYLSEFGDLNEALNSYYASQTDDQKDRREEAHWNRQQEKALKQEAF 70

  Fly    58 QANESNRDLHSL--------------LSEISRRK---------------EGDHDGYQACASD--- 90
            ..|.||:.:::.              .:|..:||               .|::..:.: .||   
Yeast    71 STNSSNKAINTEHVGGLCPKPGSSQGSNEYLKRKGSTSPEPTKGSSRSGSGNNSRFMS-FSDMVR 134

  Fly    91 ---SSTDHDTP-----AGKRVNINSSTPAITN-----------------------NDSDRSL--- 121
               ...|.|.|     .|:...:..:.|:..|                       :|.|..:   
Yeast   135 GQADDDDEDQPRNTFAGGETSGLEVTDPSDPNSLLKDLLEKARRGGQMGAENGFRDDEDHEMGAN 199

  Fly   122 RVWGHGNRLGSAHPINPPPRSATEDSDTEPADD---------EHTIVVLHLWSEGFSLDDGSLRL 177
            |..|.|.||||           |.|:..|..:|         |.....:..|.|||.:.||.|..
Yeast   200 RFTGRGFRLGS-----------TIDAADEVVEDNTSQSQRRPEKVTREITFWKEGFQVADGPLYR 253

  Fly   178 YALPENERFLRAILRGDFPEEMLRV---PRVQLSVQDHTNESYRHLSRK--QFMGPGRPLNSPSP 237
            |..|.|..:|..:.:|..|.::|.|   ..|:::|....:|||:..:||  .|.|.|:.|.||.|
Yeast   254 YDDPANSFYLSELNQGRAPLKLLDVQFGQEVEVNVYKKLDESYKAPTRKLGGFSGQGQRLGSPIP 318

  Fly   238 QILVVGPMP------VEAQGLQLNE-RADTTTVQLRMADGSRVAGRFNLTHNVGDLYQYARLARP 295
            .......:|      .:.|.:..|| :...|::|:|.|:|.|.....|.|..|..||::......
Yeast   319 GESSPAEVPKNETPAAQEQPMPDNEPKQGDTSIQIRYANGKREVLHCNSTDTVKFLYEHVTSNAN 383

  Fly   296 EFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQ 333
            ....|:|.|..|||.:. :.:|..||..|:|.|.||:|
Yeast   384 TDPSRNFTLNYAFPIKP-ISNDETTLKDADLLNSVVVQ 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 10/28 (36%)
SEP 155..242 CDD:197786 30/91 (33%)
p47_UBX 257..336 CDD:176365 26/77 (34%)
SHP1NP_009495.1 UBA_Ubx1_like 6..41 CDD:270536 10/34 (29%)
SEP 231..323 CDD:197786 30/91 (33%)
p47_UBX 345..423 CDD:176365 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C39548046
eggNOG 1 0.900 E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000961
OrthoInspector 1 1.000 T634655
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23333
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.