DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and PUX4

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_567262.1 Gene:PUX4 / 825736 AraportID:AT4G04210 Length:303 Species:Arabidopsis thaliana

Alignment Length:326 Identity:99/327 (30%)
Similarity:151/327 (46%) Gaps:64/327 (20%)


  Fly    45 SKKQEPEKSSEHSQANESNRDLHSLLSEISRRKEGDHDGYQACASDSSTDHDTP-----AGKRVN 104
            ||.::|.|.|       |:|.....||:::||.          ..||.:|.|.|     .|::..
plant     3 SKDKKPSKPS-------SSRGGIRTLSDLNRRS----------GPDSDSDSDGPQEYYTGGEKSG 50

  Fly   105 INSSTPAITNNDSDRSLRVWGHGNRLGSAH-PINPPPRSAT----------EDSDT---EPADDE 155
            :....|: ..:|.|   .::....:||:.. |:.|||.|.:          |:..|   :|....
plant    51 MLVQDPS-KKDDVD---EIFNQARQLGAVEGPLEPPPSSRSFTGTGRLLSGENVPTGNQQPEPVV 111

  Fly   156 HTIVVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEM----LRVP-RVQLSVQDHTNE 215
            |.||   .||.||::|||.||....|||..||.:|.:.:.|:|:    .|.| .|.|..::....
plant   112 HNIV---FWSNGFTIDDGPLRKLDDPENASFLESIRKSECPKELEPADRRAPVHVNLMRKEEKCP 173

  Fly   216 SYRHLSRKQFMGPGRPL-------NSPSPQILVVGPMPVE-----AQGLQLNERADTTTVQLRMA 268
            . |...|..|.|.||.|       .|.||......|:|::     :|.|.::|...||::|||:|
plant   174 E-RQKRRVSFQGVGRTLGGSNEGSGSSSPVAPDSAPIPIQTEPAPSQSLVIDETVPTTSIQLRLA 237

  Fly   269 DGSRVAGRFNLTHNVGDLYQYARLARPEFSDRSFVLMT-AFPRQELVESDTRTLVQANLCNVVVI 332
            ||:|:..:||..|.|.|:..:...:||..| .::.|.| .||.:.|.:. |:|:.:|.|.|.||:
plant   238 DGTRLVAKFNHHHTVNDIRGFIDSSRPGAS-LNYQLQTMGFPPKPLTDL-TQTIEEAGLANSVVL 300

  Fly   333 Q 333
            |
plant   301 Q 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 34/99 (34%)
p47_UBX 257..336 CDD:176365 30/79 (38%)
PUX4NP_567262.1 SEP 108..189 CDD:197786 30/85 (35%)
UBQ 228..302 CDD:294102 30/77 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175850at2759
OrthoInspector 1 1.000 T32287
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23333
Phylome 1 0.910 0.857 Consistency score
44.020

Return to query results.
Submit another query.