DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Ubxn2a

DIOPT Version :10

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001102952.1 Gene:Ubxn2a / 685859 RGDID:1589027 Length:258 Species:Rattus norvegicus


Alignment Length:238 Identity:70/238 - (29%)
Similarity:113/238 - (47%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PINPPPRSATE---DSDTEPAD------------DEHTIVVLHLWSEGFSLDDGSLRLYALPENE 184
            |:|..|:...|   ||..|.|:            .:...|.:.||..||:::| ..|.|:...::
  Rat    25 PLNDNPQKDCEYFVDSLFEEAEKAGAKCLSPTEQKKQVDVNIKLWKNGFTVND-DFRSYSDGASQ 88

  Fly   185 RFLRAILRGDFPEEMLRV---PRVQLSVQDHTNESYRHLSRK----QFMGPGRPLNSPSPQILVV 242
            :||.:|.:|:.|.|:..|   ..|.:.|:|..||..  :|.|    .|.|.|..|.|.:|:| |.
  Rat    89 QFLNSIKKGELPSELQGVFDKDEVDVKVEDKKNEVC--MSTKPVFQPFSGQGHRLGSATPRI-VS 150

  Fly   243 GPMPVEA------QGLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRS 301
            ....:|.      ..:.||.....|.:|:.:|:|.|...|||::|.|..:..:  :.:.:.:.||
  Rat   151 KAKSIEVDNKSTLSAVSLNNLEPITRIQIWLANGERTVQRFNISHRVSHIKDF--IEKYQGTQRS 213

  Fly   302 --FVLMTAFPRQELVESDTRTLVQANLCNVVVIQHLNEEQVEP 342
              |.|.||.|....:: :|.||.:|:|.|.|:||.| ::..||
  Rat   214 PPFALATALPFLRFLD-ETLTLEEADLQNAVIIQRL-QKTAEP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 29/93 (31%)
UBX_UBXN2 262..334 CDD:340468 24/73 (33%)
Ubxn2aNP_001102952.1 Required for inhibition of CHRNA3 ubiquitination and translocation of CHRNA3 to the plasma membrane resulting in an increase in acetylcholine-gated nicotinic acetylcholine receptor currents. /evidence=ECO:0000250|UniProtKB:Q99KJ0 1..165 39/143 (27%)
Required for interaction with CHRNA3. /evidence=ECO:0000250|UniProtKB:P68543 1..152 38/130 (29%)
SEP 66..139 CDD:462348 23/75 (31%)
Required for interaction with VCP. /evidence=ECO:0000250|UniProtKB:P68543 168..258 31/91 (34%)
UBX_UBXN2A 168..251 CDD:340680 29/86 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.