DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Ubxn2a

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001102952.1 Gene:Ubxn2a / 685859 RGDID:1589027 Length:258 Species:Rattus norvegicus

Alignment Length:242 Identity:71/242 - (29%)
Similarity:111/242 - (45%) Gaps:46/242 - (19%)


  Fly   135 PINPPPRSATE---DSDTEPAD------------DEHTIVVLHLWSEGFSLDDGSLRLYALPENE 184
            |:|..|:...|   ||..|.|:            .:...|.:.||..||:::| ..|.|:...::
  Rat    25 PLNDNPQKDCEYFVDSLFEEAEKAGAKCLSPTEQKKQVDVNIKLWKNGFTVND-DFRSYSDGASQ 88

  Fly   185 RFLRAILRGDFPEEMLRV---PRVQLSVQDHTNESYRHLSRK----QFMGPGRPLNSPSPQILVV 242
            :||.:|.:|:.|.|:..|   ..|.:.|:|..||..  :|.|    .|.|.|..|.|.:|:| |.
  Rat    89 QFLNSIKKGELPSELQGVFDKDEVDVKVEDKKNEVC--MSTKPVFQPFSGQGHRLGSATPRI-VS 150

  Fly   243 GPMPVEA------QGLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGDL------YQYARLARP 295
            ....:|.      ..:.||.....|.:|:.:|:|.|...|||::|.|..:      ||..:.:.|
  Rat   151 KAKSIEVDNKSTLSAVSLNNLEPITRIQIWLANGERTVQRFNISHRVSHIKDFIEKYQGTQRSPP 215

  Fly   296 EFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQHLNEEQVEP 342
                  |.|.||.|....:: :|.||.:|:|.|.|:||.| ::..||
  Rat   216 ------FALATALPFLRFLD-ETLTLEEADLQNAVIIQRL-QKTAEP 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 29/93 (31%)
p47_UBX 257..336 CDD:176365 27/84 (32%)
Ubxn2aNP_001102952.1 SEP 66..138 CDD:285322 23/74 (31%)
p47_UBX 171..249 CDD:176365 28/85 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C39502776
eggNOG 1 0.900 E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175850at2759
OrthoFinder 1 1.000 FOG0000961
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23333
Phylome 1 0.910 0.681 Consistency score
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.