DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and NSFL1C

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_011527602.1 Gene:NSFL1C / 55968 HGNCID:15912 Length:375 Species:Homo sapiens

Alignment Length:383 Identity:116/383 - (30%)
Similarity:180/383 - (46%) Gaps:65/383 - (16%)


  Fly     4 EQKLSTFMKRHGVREEVARQYLSSNNWSLEVA-SSTYES--------------EAVSKKQEPEKS 53
            ::.|..|:...|..|:.||.:|.|..|.|::| :|.||.              .:||:...|.:.
Human     6 QEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPREK 70

  Fly    54 SEHSQANESNRDLHSLLSEISRRKEGDHDGYQACASDSS------------------------TD 94
            |::...  |.|||.....|....:||....:.|..|:.|                        .:
Human    71 SDNRVT--SFRDLIHDQDEDEEEEEGQRSRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKE 133

  Fly    95 HDTPAGKRVNINSSTPAITNNDSDRSLRVWGHGNRLGSAHPINPPPRSATEDSDTEPADDEHTIV 159
            |...|.:||   :.:|..|:.....:    |.|.|||:|    |...||....:......:...|
Human   134 HGAVAVERV---TKSPGETSKPRPFA----GGGYRLGAA----PEEESAYVAGEKRQHSSQDVHV 187

  Fly   160 VLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRVP---RVQLSVQDHTNESY--RH 219
            ||.||..|||||:|.||.|..|.|.:||.:|.||:.|.|:.|:.   :|.|.::||.:|.:  ..
Human   188 VLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPK 252

  Fly   220 LSRKQFMGPGRPLNSPSPQILVVGPMPVEAQ-------GLQLNERADTTTVQLRMADGSRVAGRF 277
            .:.|.|.|.|:.|.|.:||:|.......:|:       .:.::|...||.:|:|:|||.|:..:|
Human   253 GAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQIRLADGGRLVQKF 317

  Fly   278 NLTHNVGDLYQYARLARPEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQHL 335
            |.:|.:.|:..:...|||..:..||:|||.||.:||.: :::||.:|||.|.|::|.|
Human   318 NHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELAD-ESQTLKEANLLNAVIVQRL 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 11/29 (38%)
SEP 155..242 CDD:197786 38/91 (42%)
p47_UBX 257..336 CDD:176365 33/79 (42%)
NSFL1CXP_011527602.1 UBA_p47 7..45 CDD:270533 14/37 (38%)
SEP 183..275 CDD:197786 38/91 (42%)
p47_UBX 297..375 CDD:176365 33/79 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C39505419
eggNOG 1 0.900 E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175850at2759
OrthoFinder 1 1.000 FOG0000961
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23333
Phylome 1 0.910 0.793 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.