DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and ubxn2a

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001004828.1 Gene:ubxn2a / 448090 XenbaseID:XB-GENE-972873 Length:252 Species:Xenopus tropicalis

Alignment Length:245 Identity:71/245 - (28%)
Similarity:124/245 - (50%) Gaps:30/245 - (12%)


  Fly   118 DRSLRVWGHGN---RLGSAHPINPPPRSATEDSDTEPA-------DDEHTIVVLHLWSEGFSLDD 172
            ||..|..|.|:   |..|.  :|    |..|:::...|       :|.:..|::.:|..||:::|
 Frog    14 DRGFRSGGRGSERKRCDSF--VN----SLFEEAENAGAFIASPEDEDSNADVIIKMWKNGFTIND 72

  Fly   173 GSLRLYALPENERFLRAILRGDFPEEMLRV---PRVQLSVQDHTNESYRHLSRK----QFMGPGR 230
            |.||.|:..||.:|:.::.:|:.|||:.:.   ..:.::|:|..||.|  |.||    .|.|.|.
 Frog    73 GYLRDYSGAENRQFMDSVRKGELPEELQKTFDKEEIAVNVEDRKNEEY--LLRKPNIDAFSGLGH 135

  Fly   231 PLNSPSPQILVVGPMPVEAQGL---QLNERADTTTVQLRMADGSRVAGRFNLTHNVGDLYQYARL 292
            .|.|.:|:::.........|.|   .|||....|.:::.:|||.|:..:||.:|.:.|:..:...
 Frog   136 RLGSAAPKVITKDMETCNEQSLPSVDLNELEPLTNIKVWLADGKRIVQKFNTSHRISDVRDFLER 200

  Fly   293 ARPEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQHLNEEQVEP 342
            ...:..:..|.|.|:||..:|:: ::.|:.:|.|.|.|::|.| :...||
 Frog   201 IPCKPGNAPFTLATSFPLHDLLD-ESLTIQEAELQNSVLVQKL-QRTTEP 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 30/93 (32%)
p47_UBX 257..336 CDD:176365 21/78 (27%)
ubxn2aNP_001004828.1 SEP 61..135 CDD:311829 25/75 (33%)
p47_UBX 165..243 CDD:176365 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C39501931
eggNOG 1 0.900 E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175850at2759
OrthoFinder 1 1.000 FOG0000961
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.