DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Nsfl1c

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_938085.1 Gene:Nsfl1c / 386649 MGIID:3042273 Length:372 Species:Mus musculus

Alignment Length:383 Identity:120/383 - (31%)
Similarity:179/383 - (46%) Gaps:60/383 - (15%)


  Fly     1 MTDEQK--LSTFMKRHGVREEVARQYLSSNNWSLEVA-SSTYE----SEAVSKKQEPEKSSEHSQ 58
            |.:|::  |..|:...|..|:.||.:|.|..|.|::| :|.||    .:.|:..|....|.....
Mouse     1 MAEERQDALREFVAVTGTEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGT 65

  Fly    59 ANESN-----RDLHSLLSEISRRKEGDHDGYQACASDSS------------------------TD 94
            |...|     |||.....|....:||....:.|..|:.|                        .:
Mouse    66 APSDNRVTSFRDLIHDQDEEEEEEEGQRSRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKE 130

  Fly    95 HDTPAGKRVNINSSTPAITNNDSDRSLRVWGHGNRLGSAHPINPPPRSATEDSDTEPADDEHTIV 159
            |...|.:||   :.:|..|:.....:    |.|.|||:|    |...||....:......:...|
Mouse   131 HGAVAVERV---TKSPGETSKPRPFA----GGGYRLGAA----PEEESAYVAGERRRHSGQDVHV 184

  Fly   160 VLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRVP---RVQLSVQDHTNESY--RH 219
            ||.||..|||||:|.||.|..|.|.:||.:|.||:.|.|:.|:.   :|.|.::||.:|.:  ..
Mouse   185 VLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPK 249

  Fly   220 LSRKQFMGPGRPLNSPSPQILVVGPMPVEAQ-------GLQLNERADTTTVQLRMADGSRVAGRF 277
            .:.|.|.|.|:.|.|.:||:|.......:|:       .:.:||...||.:|:|:|||.|:..:|
Mouse   250 GAFKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQIRLADGGRLVQKF 314

  Fly   278 NLTHNVGDLYQYARLARPEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQHL 335
            |.:|.:.|:..:...|||..:..||||||.||.:||.: :.:||.:|||.|.|::|.|
Mouse   315 NHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELAD-ENQTLKEANLLNAVIVQRL 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 11/29 (38%)
SEP 155..242 CDD:197786 38/91 (42%)
p47_UBX 257..336 CDD:176365 34/79 (43%)
Nsfl1cNP_938085.1 UBA_p47 7..45 CDD:270533 14/37 (38%)
Nuclear localization signal 111..117 0/5 (0%)
Nuclear localization signal 174..177 0/2 (0%)
SEP 180..272 CDD:197786 38/91 (42%)
p47_UBX 294..372 CDD:176365 34/79 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C39507803
eggNOG 1 0.900 E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000961
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23333
Phylome 1 0.910 0.776 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.