DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and p47

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster

Alignment Length:419 Identity:120/420 (29%)
Similarity:189/420 (45%) Gaps:110/420 (26%)


  Fly     7 LSTFMKRHGVREEVARQYLSSNNWSLEVASSTYES-------------EAVSKKQEPEKSSEHSQ 58
            ::.|::..|..|.|||.||||.:|.:|.|...|.|             .|.:.|.:|..||..|.
  Fly     8 IAQFIEITGTDENVARFYLSSCDWDIEHALGNYWSTQADLPVPVPTVGHADNPKPKPTSSSGASA 72

  Fly    59 A----------------NESNRDL----------HSLLSEISRRKEGDHD--GYQACASDSSTDH 95
            :                :.::.|:          .:.||::|:....|.|  .:.|..||.|...
  Fly    73 SASAAGATKSADSAVATSSASVDIAPAATKAKPKFATLSDMSKESSSDDDQQAFYAGGSDRSGQQ 137

  Fly    96 DTPAGKRVNINSSTPAITNNDSDRSL------------------RVWGHGNRLGSAHPINPPPRS 142
            .....||.|.......:..:..::::                  .|||.|.|||.          
  Fly   138 VLGPPKRKNFREQLTDMMRSAQEQNIAEVGPSTSSGSASGGSGGAVWGQGMRLGM---------- 192

  Fly   143 ATEDSDTEPADDEHT---------------IVVLHLWSEGFSLDDGSLRLYALPENERFLRAILR 192
                     .|::||               :|||.|||:|||:|.|.||.|..|:|:.||..::|
  Fly   193 ---------TDNDHTAVGTKKPAATIENKPVVVLKLWSQGFSIDGGELRHYDDPQNKEFLETVMR 248

  Fly   193 GDFPEEMLRVPR-VQLSVQDHTNESYRHLSRKQ-FMGPGRPLNSPSPQILVVGP------MPVEA 249
            |:.|:|:|.:.| |.:.|:||.:|.::.....| |.|.|:.|.||...::...|      .|.||
  Fly   249 GEIPQELLEMGRMVNVDVEDHRHEDFKRQPVPQTFKGSGQKLGSPVANLVTEAPTVPVALSPGEA 313

  Fly   250 --------QGLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRSFVLMT 306
                    ..:.||..|.:||:|:|:|||||:|.:|||:|.|.|:.::.:.|||::|..:|:|::
  Fly   314 ANQEASARDAINLNSEAPSTTLQIRLADGSRLAAQFNLSHTVSDIRRFIQTARPQYSTSNFILVS 378

  Fly   307 AFPRQELVESDTRTLVQANLCNVVVIQHL 335
            :||.:|| ..|..|:.:|.|.|..::|.|
  Fly   379 SFPTREL-SDDNSTIEKAGLKNAALMQRL 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 13/29 (45%)
SEP 155..242 CDD:197786 38/104 (37%)
p47_UBX 257..336 CDD:176365 34/80 (43%)
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612 14/34 (41%)
SEP 211..300 CDD:197786 36/89 (40%)
p47_UBX 329..407 CDD:176365 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C39491672
eggNOG 1 0.900 E1_KOG2086
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3837
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175850at2759
OrthoFinder 1 1.000 FOG0000961
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23333
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.