DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Ubxn2b

DIOPT Version :9

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001101375.1 Gene:Ubxn2b / 312965 RGDID:1308557 Length:331 Species:Rattus norvegicus


Alignment Length:334 Identity:108/334 - (32%)
Similarity:162/334 - (48%) Gaps:58/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EPEKSSEHSQANE--SNRDLHSLLSEI----SRRKEGDHDGYQACASDS---------STDHD-- 96
            |||:....|....  |.|||...|:|:    .:.|....|...|.|..|         |.|.:  
  Rat     8 EPEEQERRSSRPRPPSARDLQLALAELYEDEMKCKSSKPDRSTATAFKSPRTPPLRLYSGDQEYG 72

  Fly    97 ------TPAGKRVN-------------INSSTPAITNNDSDRSLRVWGHGNRLGSAHPINPPPRS 142
                  .|.||.||             :|.:|   .::..|::....|.|.||||:.    ..||
  Rat    73 GLHIAQPPTGKIVNELFKEAREHGAVPLNEAT---RSSSDDKAKSFTGGGYRLGSSF----YKRS 130

  Fly   143 ATEDSDTEPADDEHTIVVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV---PR 204
            .....:.:..|.:   ::|.|||.|||||||.||.|:.|.|.:||.::.||:.|.|:.|:   .:
  Rat   131 EYIYGENQLQDVQ---ILLRLWSNGFSLDDGELRPYSDPTNAQFLESVKRGEIPLELQRLVHGSQ 192

  Fly   205 VQLSVQDHTNESY--RHLSRKQFMGPGRPLNSPSPQILVVGPMPVEAQGLQLN------ERADTT 261
            |.|.::||.::.|  ..|..|.|.|.|:.|.|.:|:|:.....|.|.....||      :...||
  Rat   193 VSLDMEDHQDQEYIKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEEEDKSILNAAVLIDDSVPTT 257

  Fly   262 TVQLRMADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRSFVLMTAFPRQELVESDTRTLVQANL 326
            .:|:|:|||||:..|||.||.:.|:..:...:||||:...|:|:|:||.:||.: ::.||..|::
  Rat   258 KIQIRLADGSRLIQRFNSTHRILDVRDFIVQSRPEFATTDFILVTSFPSKELTD-ESVTLQDADI 321

  Fly   327 CNVVVIQHL 335
            .|.|::|.|
  Rat   322 LNTVILQQL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 37/91 (41%)
p47_UBX 257..336 CDD:176365 33/79 (42%)
Ubxn2bNP_001101375.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..63 5/24 (21%)
SEP 140..232 CDD:197786 38/94 (40%)
p47_UBX 253..331 CDD:176365 33/79 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23333
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.