DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and Ubxn2a

DIOPT Version :10

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_663416.1 Gene:Ubxn2a / 217379 MGIID:2442310 Length:258 Species:Mus musculus


Alignment Length:208 Identity:64/208 - (30%)
Similarity:105/208 - (50%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PADDEHTI-VVLHLWSEGFSLDDGSLRLYALPENERFLRAILRGDFPEEMLRV---PRVQLSVQD 211
            |.:.:..: |.:.||..||:::| ..|.|:...:::||.:|.:|:.|.|:..:   ..|.:.|:|
Mouse    55 PTEQKKQVDVNIKLWKNGFTVND-DFRSYSDGASQQFLNSIKKGELPSELWGIFDKEEVDVKVED 118

  Fly   212 HTNESYRHLSRK----QFMGPGRPLNSPSPQILVVGPMPVEA------QGLQLNERADTTTVQLR 266
            ..||..  :|.|    .|.|.|..|.|.:|:| |.....||.      ..:.||.....|.:|:.
Mouse   119 KKNEVC--MSTKPVFQPFSGQGHRLGSATPRI-VSKAKSVEVDNKSTLSAVSLNNLEPITRIQIW 180

  Fly   267 MADGSRVAGRFNLTHNVGDLYQYARLARPEFSDRS--FVLMTAFPRQELVESDTRTLVQANLCNV 329
            :|:|.|...|||::|.|..:..:  :.:.:.|.||  |.|.||.|....:: :|.||.:|:|.|.
Mouse   181 LANGERTVQRFNVSHRVSHIKDF--IEKYQGSQRSPPFALATALPFLRFLD-ETLTLEEADLKNA 242

  Fly   330 VVIQHLNEEQVEP 342
            |:||.| ::..||
Mouse   243 VIIQRL-QKTAEP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 28/94 (30%)
UBX_UBXN2 262..334 CDD:340468 25/73 (34%)
Ubxn2aNP_663416.1 Required for inhibition of CHRNA3 ubiquitination and translocation of CHRNA3 to the plasma membrane resulting in an increase in acetylcholine-gated nicotinic acetylcholine receptor currents. /evidence=ECO:0000269|PubMed:19474315 1..165 32/113 (28%)
Required for interaction with CHRNA3. /evidence=ECO:0000250|UniProtKB:P68543 1..152 30/100 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
SEP 66..139 CDD:462348 22/75 (29%)
Required for interaction with VCP. /evidence=ECO:0000250|UniProtKB:P68543 168..258 32/91 (35%)
UBX_UBXN2A 168..251 CDD:340680 30/86 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.