| Sequence 1: | NP_523847.2 | Gene: | CG42383 / 37897 | FlyBaseID: | FBgn0259729 | Length: | 353 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_003200800.2 | Gene: | ubxn2a / 100537478 | ZFINID: | ZDB-GENE-110411-202 | Length: | 258 | Species: | Danio rerio |
| Alignment Length: | 308 | Identity: | 78/308 - (25%) |
|---|---|---|---|
| Similarity: | 133/308 - (43%) | Gaps: | 95/308 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 42 EAVSKKQEPEKSSEHSQANESNRDLHSLLSEISRRKEGDHDGYQACASDSSTDHDTPAGKRVNIN 106
Fly 107 SSTPAITNNDSDRSLRVWGHGNRLGSAHPINPPPRSATEDSDTEPADDEHTIVVLHLWSEGFSLD 171
Fly 172 DGSLRLYALPENERFLRAILRGDFPEEM---LRVPRVQLSVQDHTNESYRHLSRKQ----FMGPG 229
Fly 230 RPLNSPSPQILV---------VGPMPVEAQGLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGD 285
Fly 286 LYQYARLARPEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQ 333 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42383 | NP_523847.2 | UBA_TAP-C_like | 10..39 | CDD:270459 | |
| SEP | 155..242 | CDD:197786 | 30/102 (29%) | ||
| p47_UBX | 257..336 | CDD:176365 | 26/77 (34%) | ||
| ubxn2a | XP_003200800.2 | SEP | 66..139 | CDD:285322 | 25/74 (34%) |
| UBQ | 175..247 | CDD:294102 | 26/75 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1175850at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||