DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and ubxn2a

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_003200800.2 Gene:ubxn2a / 100537478 ZFINID:ZDB-GENE-110411-202 Length:258 Species:Danio rerio

Alignment Length:308 Identity:78/309 (25%)
Similarity:133/309 (43%) Gaps:95/309 (31%)


  Fly    42 EAVSKKQEPEKSSEHSQANESNRDLHSLLSEISRRKEGDHDGYQACASDSSTDHDTPAGKRVNIN 106
            |....::|.|:..|.:....|:..:..||.|:.:        ..:.||         :||:|.| 
Zfish    18 EGAQNEEEEEEEDEEASPIRSSFSVEDLLDEVEK--------ISSVAS---------SGKKVEI- 64

  Fly   107 SSTPAITNNDSDRSLRVWGHGNRLGSAHPINPPPRSATEDSDTEPADDEHTIVVLHLWSEGFSLD 171
                                                                 |:.||..||:|:
Zfish    65 -----------------------------------------------------VVRLWKNGFTLN 76

  Fly   172 DGSLRLYALPENERFLRAILRGDFPEEM---LRVPRVQLSVQDHTNESYRHLSRKQ----FMGPG 229
            |..||.|...||:.||.||.:|:.|.|:   .....::::|:|..:|.|  :.:|:    |.|.|
Zfish    77 DEDLRSYTQEENQEFLEAIKKGELPLELEGRAEDEELEVNVEDMKDEVY--VPKKKIFHPFTGRG 139

  Fly   230 RPLNSPSPQILV---------VGPMPVEAQGLQLNERADTTTVQLRMADGSRVAGRFNLTHNVGD 285
            ..|.|.:|:::.         .|| ||.|  ::|||....|::|:.:|||.|:..||||.|.:.|
Zfish   140 YRLGSVAPRVVARSRSIHEDCSGP-PVPA--VELNEDLPVTSLQIWLADGRRLVQRFNLCHRISD 201

  Fly   286 LYQYARLARPEFSDRSFVLMTAFPRQELVESDTRTLVQANLCNVVVIQ 333
            :.::...|  :.:|..|:|.|:.|.:||.: :.::|.:|:|.|.|::|
Zfish   202 VQRFVEQA--QITDTPFILTTSLPFRELTD-EAQSLEEADLANAVIVQ 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459
SEP 155..242 CDD:197786 30/103 (29%)
p47_UBX 257..336 CDD:176365 26/78 (33%)
ubxn2aXP_003200800.2 SEP 66..139 CDD:285322 25/75 (33%)
UBQ 175..247 CDD:294102 26/76 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C39505603
eggNOG 1 0.900 E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175850at2759
OrthoFinder 1 1.000 FOG0000961
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.