DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42383 and ubxn11

DIOPT Version :8

Sequence 1:NP_523847.2 Gene:CG42383 / 37897 FlyBaseID:FBgn0259729 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_002934683.1 Gene:ubxn11 / 100493049 XenbaseID:XB-GENE-985480 Length:524 Species:Xenopus tropicalis

Alignment Length:427 Identity:91/427 - (21%)
Similarity:147/427 - (34%) Gaps:118/427 - (27%)


  Fly     2 TDEQKLSTFMKRHGVREEVAR---QYLSSNNW-------SLEVASSTYESEAVSKKQEPEKSSEH 56
            :|...|::.|||.|..|...|   |.:.|.:.       .::.....:...|.|.::|.|...:.
 Frog   132 SDFDLLNSTMKRLGELERRVRAQEQEIQSKDQEIRDLEKKIKRLQQLHSGNATSGRREQELEHQC 196

  Fly    57 SQANESNRDLHSLLSEISRRKEGDHDGYQACASDSSTDHDTPAGKRVNINSSTPAITNNDSD--- 118
            .:.|:...::...|.:......|:::   |..|..||......|      .|:|.....|.|   
 Frog   197 KELNKKISEMERFLGDYGLVWVGENN---ADVSPESTARTWSPG------PSSPTSFLPDFDLVL 252

  Fly   119 ---RSLRVWG-----H------GNRLGSAHPINPPPRSATEDSDTEPADDEHTIVVLHLWSEGFS 169
               |.|.|.|     |      |.||.:       |.|                |.|.|:..|..
 Frog   253 ENLRDLNVLGGEGESHIEYQKGGARLRA-------PES----------------VPLTLYKNGII 294

  Fly   170 LDDGSLRLYALPENERFLRAILRGDFPEEM-LRVPR-VQLSVQDHTNESYRHLSR-KQFMGPGRP 231
            :..|..|.|.....:..:|.|:.|.||.|: .|.|. |...|.|:.|..::...| ..|.|.|:.
 Frog   295 MFQGPFRSYKEKSTQLCIRDIMDGYFPSELQARFPNGVTFQVTDNRNVIFQEQRRWDDFPGSGQT 359

  Fly   232 LNS----------PSPQI------------LVVG----------------------PMPVEAQGL 252
            :.|          |.||:            ::.|                      |..:..:..
 Frog   360 IGSSGSNLQTNKKPGPQLSTDQFLNRLPKSVIRGGRIVHVRSAVREALQGSEENEMPKEILVESP 424

  Fly   253 QLNERADT------TTVQLRMADGSRV-AGRFNLTHNVGDLYQYARLAR-PEFSDRSFVLMTAFP 309
            ||::...|      :|:::|...|.:. ..|...:..:.||..|....| |:.|  |:.::|.||
 Frog   425 QLSKEQSTQDNMVVSTLRIRSESGDKTYKVRMLSSETLADLRNYLSSCRAPDLS--SYNIITPFP 487

  Fly   310 RQELVESDTRTLVQANLC-NVVVIQHLNEEQVEPLSS 345
             ..:.|.||.||.:..|. |..::.....|:.:...|
 Frog   488 -YCVYEDDTCTLEEVGLVPNAFLVLRARSEEEQKKQS 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42383NP_523847.2 UBA_TAP-C_like 10..39 CDD:270459 8/38 (21%)
SEP 155..242 CDD:197786 27/111 (24%)
p47_UBX 257..336 CDD:176365 22/87 (25%)
ubxn11XP_002934683.1 Nup54 <145..>203 CDD:290585 10/57 (18%)
SEP 286..357 CDD:285322 21/70 (30%)
UBQ 438..512 CDD:294102 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C39500180
eggNOG 1 0.900 E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.