DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rpn8 and rpn8

Sequence 1:NP_001261167.1 Gene:Rpn8 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_587803.1 Gene:rpn8 PomBaseID:SPCC1682.10 Length:324 Species:Schizosaccharomyces pombe

Alignment Length:332 Identity:161/333 (48%)
Similarity:237/333 (71%) Gaps:30/333 (9%)


  Fly     1 MP---SQEVSV---NKVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKG-VLDVSNSFA 58
            ||   |.|.|.   .:||||||||||.||.:||..| |.::||||:|||  ::.| |::|:||:|
pombe     1 MPPAVSSETSTIVPQQVIVHPLVLLSAVDSYNRSAK-GTKRRVVGILLG--QNNGDVVNVANSYA 62

  Fly    59 VPFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSV 123
            :||:||:|:.|||||||:::|:|..||||:||.|::||||||||:|..:|:.||.|:::|.||.|
pombe    63 IPFEEDEKNASVWFLDHNFMESMNEMFKKINANEKLVGWYHTGPQLRPSDLEINNLLKKYIPNPV 127

  Fly   124 LVIIDAKPKDLGLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVG 188
            |||||.|||.:||||.||.:::|:.||||.:|:||.|:||.|.||||||:||||||||.:|.:||
pombe   128 LVIIDVKPKSVGLPTNAYFAIDEIEDDGSKSSRTFVHLPSSIEAEEAEEIGVEHLLRDTRDASVG 192

  Fly   189 SLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMY 253
            :|:.::|.|...|:||..:|.:|..||::|.|.::||||.|:.:||.:|||||:|    |:|.:.
pombe   193 TLATRVTQQAQSLQGLGQRLTEIADYLRKVVDGQLPINHAILAELQSVFNLLPNI----FSGPVV 253

  Fly   254 --------------VKTNDQMLVVYLASMVRSIIALHNLINNKLANRDAEEGKSDSKEAKEKNKD 304
                          |.:|||::.:|::|:||::||||:|:::..|::..|:  .|.|...:..:.
pombe   254 SEQALESEAQRAFNVNSNDQLMSIYISSIVRAVIALHDLLDSLAASKAMEQ--QDIKPTVQNGEV 316

  Fly   305 SKDKDNK 311
            |.:.:.|
pombe   317 SANAEQK 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 156/319 (49%)
MPN_RPN7_8 9..290 CDD:163693 152/296 (51%)
rpn8NP_587803.1 PLN03246 14..304 CDD:215645 152/297 (51%)
MPN_RPN7_8 15..304 CDD:163693 152/296 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2104
Inparanoid 1 1.050 315 1.000 Inparanoid score I554
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004288
OrthoInspector 1 1.000 T1124452
orthoMCL 1 0.900 OOG5_127933
Panther 1 1.100 LDO PTHR10540
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1207
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.