DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rpn8 and rpn-11

Sequence 1:NP_001261167.1 Gene:Rpn8 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_494712.1 Gene:rpn-11 WormBaseID:WBGene00004467 Length:312 Species:Caenorhabditis elegans

Alignment Length:333 Identity:66/334 (20%)
Similarity:123/334 (37%) Gaps:84/334 (25%)


  Fly     3 SQEVSVNK-VIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDK 66
            |.:|..:: |.:..|.||.::.|    |:.|....|:|::||.:.....::|.:.||:|  :...
 Worm    24 SNQVDTSETVYISSLALLKMLKH----GRAGVPMEVMGLMLGEFVDDYTVNVIDVFAMP--QSGT 82

  Fly    67 DKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPK----LHQNDIAINELVRRYCPNSVLVII 127
            ..||..:|..:...|..|.|:....|.||||||:.|.    |...||...:........:|.|::
 Worm    83 GVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSDRAVAVVV 147

  Fly   128 DAKPKDLGLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQ 192
            |.                                                 ::.:|...|....:
 Worm   148 DP-------------------------------------------------IQSVKGKVVIDAFR 163

  Fly   193 KITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTN 257
            .|..|.|.|.      ::.:|....:|..:.|....:::.|...:..:|          :..:|:
 Worm   164 TINPQSMALN------QEPRQTTSNLGHLQKPSIQALIHGLNRHYYSIP----------IAYRTH 212

  Fly   258 D--QMLVVYLASMV-RSIIALHNLINNKLANRDAEEGKSDSKEAKEKNK---DSKDKDNKETKDK 316
            |  |.:::.|..:. ...:::.|.  :|...::.|..|:..|.||...|   |.|:..::|...|
 Worm   213 DLEQKMLLNLNKLSWMDAVSVENY--SKCGEQNKEHLKAMLKLAKNYKKALEDEKNMTDQELAIK 275

  Fly   317 DGKKAEEK 324
            :..|.:.|
 Worm   276 NVGKMDPK 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 60/312 (19%)
MPN_RPN7_8 9..290 CDD:163693 53/289 (18%)
rpn-11NP_494712.1 MPN_RPN11_CSN5 23..288 CDD:163700 66/334 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.