DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and fmn2a

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:XP_001333061.4 Gene:fmn2a ZFINID:ZDB-GENE-101107-1 Length:1465 Species:Danio rerio

Alignment Length:455 Identity:86/456 (19%)
Similarity:161/456 (35%) Gaps:133/456 (29%)


  Fly   296 KKRQKDLPNLQAGKKDSSKRSNS------------------SDENTVVNHASGGL-LAFAQVGGN 341
            ||.:|...:.::|||.|....:.                  |.|:.:    .||: :..|...||
Zfish   208 KKIKKSKSSAESGKKKSKSEGSKGSVFSNIRIRKGLSRKVLSKEDVL----DGGIRIKPADANGN 268

  Fly   342 DHDTWRRPRSESSPDAESVYMTNMVIDSGYHGMHSRKSSIKST-NTIKKSYTCFGSIKEWCIAWW 405
            .:.......| ..||::.:            ...||:|::.:| :.:::.....||..:.|.  :
Zfish   269 SNGGISGDES-CMPDSKQL------------TAESRQSTLDTTEDDVERETEGSGSDTDLCS--Y 318

  Fly   406 HSGRE------------------DSDDFAYEQEEPSDLGYATPVTI-ETPLQSSVSRCTS----- 446
            ||..|                  |.....:.:::...:|:...|.: ..|.:.|:: |..     
Zfish   319 HSAAEAQDLLSDIQRTIRQMEGVDERQNCHSEDKERQVGFEGHVEVTHGPTRGSLA-CEGEPEKL 382

  Fly   447 --------MNVMRDNYSMGGSVSGVRPPSILLSD--VSPTPLPRPPLASIS-------------Q 488
                    :|::....:.||.::....   :.||  |:..|.....|:|:|             .
Zfish   383 EGASDSKYLNLICSGDTTGGVITSKLK---IESDGKVADIPNKADHLSSLSSDYSIQDAVPETNS 444

  Fly   489 LQEMSAVTASTT-----ANVNTSGNGNGA---INNNNNASHNGNGAVNGNGAGNGSGIGLGTTGN 545
            :|:..|.|.||:     .|..||.:...|   :.:::.:|.......:.|.......:||    |
Zfish   445 VQDARAFTHSTSNYSFQDNTGTSTSYESAEEILESSSLSSPLEECHYDSNSLTQSLEVGL----N 505

  Fly   546 ATHRDSRTLPVINRINSRSVSQDSVYTILIRLPSDG--------------ASSNAA--------N 588
            :::..|:    |||:  ..|.|.|:.::.:.:..||              ..|:||        |
Zfish   506 SSNHMSK----INRV--IFVPQKSISSVELNVDGDGPVEEVDRGFSTQPRRKSSAASMTQWSSEN 564

  Fly   589 GGGGGPGAGAAASASLSMQGDCAPSIKMIHEDGPTTTAAAAPLASAAATRRPLPSRDSEFSLPLG 653
            ..|.|......:||:|.::.  .|:|:..:.. .||....:|:.|...|..|.|....:..|..|
Zfish   565 FLGSGSRPRRTSSANLGVKP--YPTIQTSYVK-TTTRQLTSPIISPFTTPSPSPMCPRKVGLEFG 626

  Fly   654  653
            Zfish   627  626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433
7tm_1 121..>314 CDD:278431 7/18 (39%)
fmn2aXP_001333061.4 FH2 1027..1416 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.