DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and chrm5a

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_001018639.1 Gene:chrm5a ZFINID:ZDB-GENE-080723-32 Length:490 Species:Danio rerio

Alignment Length:715 Identity:222/716 (31%)
Similarity:304/716 (42%) Gaps:277/716 (39%)


  Fly    99 YSLASMVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAV 163
            :||..::.:..|:||:|.:|:.||::||:|||::.||:|::||:|.|||.||..||..||.|:..
Zfish    20 HSLWEVIAIATVSAIVSFITIIGNILVMLSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTS 84

  Fly   164 TTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAA 228
            ..::|||.||.:.||.||||||:||||||:|||:||||||||:|||||||||||...|.:|||.|
Zfish    85 YILMGYWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKIAGIMIGLA 149

  Fly   229 WGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVTIMCFLYWRIWR 293
            |.:|.:||.|.|..|.|..||||||:.:|.|||. :...||||||:|||||||::|..||..|::
Zfish   150 WLVSFILWAPPILCWQYFVGKRTVPERQCQIQFF-SEPVITFGTAIAAFYFPVSVMTILYCLIYK 213

  Fly   294 ETKKRQKDLPNLQAGKKDSSKRSNSSDENTVVNHASGGLLAFAQVGGNDHDTWRRPRSESSPDAE 358
            ||::|.|||..||.        .|||                               :.||.||:
Zfish   214 ETERRTKDLAELQG--------INSS-------------------------------TNSSGDAQ 239

  Fly   359 SVYMTNMVIDSGYHGMH----SRKSSIKSTN---TIKKSYTCFGSIKEWCIAWWHSGREDSD--- 413
            .     ..|.|.:...|    ||..::..||   |:....|.|.|         ::..|:.|   
Zfish   240 P-----QKIRSCFGCKHVSNTSRTQALSHTNAAKTLDDQLTNFNS---------YASSEEEDRSG 290

  Fly   414 ---DFAYEQEEPSDLGYATPVTIETPLQSS---VSRCTSMNVMRDNYSMGGSVSGVRPPSILLSD 472
               :....||..|: .|.......||:::|   ..:|.|..              .:|     .|
Zfish   291 NFQESCRHQENKSE-SYEEENFFPTPVKASPTKTKKCVSYK--------------FKP-----KD 335

  Fly   473 VSPTPLPRPPLASISQLQEMSAVTASTTANVNTSGNGNGAINNNNNASHNGNGAVNGNGAGNGSG 537
            |||                                     :.|.|                    
Zfish   336 VSP-------------------------------------LKNTN-------------------- 343

  Fly   538 IGLGTTGNATHRDSRTLPVINRINSRSVSQDSVYTILIRLPSDGASSNAANGGGGGPGAGAAASA 602
                                                                |...|||.:.:||
Zfish   344 ----------------------------------------------------GDAKPGASSFSSA 356

  Fly   603 SLSMQGDCAPSIKMIHEDGPTTTAAAAPLASAAATRRPLPSRDSEFSLPLGRRMSHAQHDARLLN 667
            .         |:     :.|::::::.|:...                               |.
Zfish   357 E---------SV-----NAPSSSSSSKPIDGT-------------------------------LK 376

  Fly   668 AKVIPKQLGKAGGGAAGGGVGGAHALMNARNAAKKKKKSQEKRQESKAAKTLSAILLSFIITWTP 732
            .::                               .|:|.....:|.|||:|||||||:||:||||
Zfish   377 CQI-------------------------------TKRKRMVLIKEKKAAQTLSAILLAFILTWTP 410

  Fly   733 YNILVLIKPLTTCSDCIPTELWDFFYALCYINSTINPMCYALCNATFRRTYVRILTCKWHTRNRE 797
            |||:|||.  |.||||||..||...|.|||:|||:|||||||||.||::|:..:|.|:|..:..|
Zfish   411 YNIMVLIS--TFCSDCIPLSLWHLGYWLCYVNSTVNPMCYALCNKTFQKTFRMLLLCQWRKQRAE 473

  Fly   798  797
            Zfish   474  473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 76/124 (61%)
7tm_1 121..>314 CDD:278431 112/193 (58%)
chrm5aNP_001018639.1 7tm_4 34..>167 CDD:304433 80/133 (60%)
7tm_1 42..448 CDD:278431 203/667 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000316
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24247
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.