DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and Octbeta1R

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_001262843.1 Gene:Octbeta1R FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster

Alignment Length:300 Identity:74/300 (25%)
Similarity:134/300 (45%) Gaps:37/300 (12%)


  Fly    32 TTTTTTSTTTTTASPAGYSPGYPGTTLLTALFENLTST-----AASGLYDPYSG-MYGNQTNGTI 90
            :.|||.:....:.|..|.....|..:.:..|.|:.:..     .|.||.|...| ..|:.::..:
  Fly    11 SATTTRTILEGSISSFGGGTNEPLASKIPVLEESASHARYLKFIADGLIDEGLGSAVGSGSSIAV 75

  Fly    91 GFE-------------------TKGPRYSLASMVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQ 136
            ..|                   ..|..: ||.:.|..|:...:....:.||::|::|....::|:
  Fly    76 SVEDVVAGQAQDIQASEGSTDDADGSSH-LALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLR 139

  Fly   137 TISNYFLFSLAIADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFD 201
            .|:|||:.|||:||..:...:|...|...|.|.|..|.::||.|.:.|...|.||:::|..||.|
  Fly   140 IITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVD 204

  Fly   202 RYFSVTRPLTYRAKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQF----- 261
            ||:::.:||.|....|..|..:|:...|     |.|..:...|...|..|..::..|::.     
  Fly   205 RYYAIVQPLDYPLIMTQRRVFIMLLMVW-----LSPALLSFLPICSGWYTTTENYKYLKSNPHIC 264

  Fly   262 -IETNQYITFGTALAAFYFPVTIMCFLYWRIWRETKKRQK 300
             .:.|:.....::..:|:.|..:|..:|:||::|..::::
  Fly   265 EFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQER 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 42/124 (34%)
7tm_1 121..>314 CDD:278431 54/186 (29%)
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 40/119 (34%)
7tm_1 124..404 CDD:278431 54/186 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123105977
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.