DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and TyrR

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_001287381.1 Gene:TyrR FlyBaseID:FBgn0038542 Length:631 Species:Drosophila melanogaster

Alignment Length:790 Identity:175/791 (22%)
Similarity:272/791 (34%) Gaps:281/791 (36%)


  Fly    59 LTALFENLTSTAASGLYDPYSGMYGNQTNGT--IGFETKGPRYSLASM----------------- 104
            ::.::|:..:....|......|.|.:..|||  :.....||...:.:.                 
  Fly    45 ISIVYEDAGNGTGGGGVGGVGGGYPSGPNGTDAVALTEPGPTAPVTTFNYYNESAAAAEWAHFYD 109

  Fly   105 -------VVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFA 162
                   :::..|.|....|||.||.:|:::....::|:||:|.|:.|||:||..:|...||...
  Fly   110 LVLSWQGIILIAVFATFIVVTVIGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAV 174

  Fly   163 VTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNR-AAVMIG 226
            ...::|.|.||.::||.|::||.|...||:|:|..||.|||.:|||||||..||.:.| |.:||.
  Fly   175 AVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMIL 239

  Fly   227 AAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVTIMCFLYWRI 291
            ..|.::|.:..|.:..| |..|:|.:  .||  ::.:...|:.| :|:.:|:.|:.:|.::|.||
  Fly   240 IVWLLALAITCPPMLGW-YEPGRRDL--REC--RYNQNEGYVIF-SAMGSFFIPMAVMIYVYARI 298

  Fly   292 WRETKKRQKDLPNLQAGKKDSSKRSNSSDENTVVNHASGGLLAFAQVGGNDHDTWRRPRSESSPD 356
                                                        :.|..:.||.           
  Fly   299 --------------------------------------------SCVIASRHDN----------- 308

  Fly   357 AESVYMTNMVIDSGYHGMHSRKSSIKSTNTIKKSYTCFGSIKEWCIAWWHSGREDSDDFAYEQEE 421
                 ||::       .:|::|.         |.||.                .|.::...|||:
  Fly   309 -----MTDI-------SVHNKKF---------KRYTA----------------ADVENELSEQEQ 336

  Fly   422 PSDLGYATPVTIETPLQSSVSRCTSMNVMRDNYSMGGSVSGVRPPSILLSDVSPTPLPRPPLASI 486
            .|.:|...        :.:.||..|...:                                   .
  Fly   337 HSSVGQRQ--------RQATSRTFSNQTI-----------------------------------A 358

  Fly   487 SQLQEMSAVTASTTANVNTSGNGNGAINNNNNASHNGNGAVNGNGAGNGSGIGLGTTGNATHRDS 551
            .:||:|                   .:::::|.:..|.|...|.|.|..|..|      .||..|
  Fly   359 KELQDM-------------------MLSDSDNCAAMGAGGAGGGGGGASSATG------GTHCQS 398

  Fly   552 RTLPVINRINSRSVSQDSVYTILIRLPSDGASSN---AANG------------------------ 589
                                  |:.|||.|...:   |.||                        
  Fly   399 ----------------------LLALPSGGVGGSMGCAKNGCYELTRPSSLKRASTASTTITTMT 441

  Fly   590 GGGGPGAGAAASASLSMQGDCAPSIKMIHEDGPTTTAAAAPLASAAATRRPLPSRDSEFSLPLGR 654
            .|.|||     |:.|..|....|       .|.|.......|:.        |.|...|      
  Fly   442 SGMGPG-----SSLLDAQWQSQP-------PGQTGQVQTHSLSQ--------PPRTHSF------ 480

  Fly   655 RMSHAQHDARLLNAKVIPKQLGKAGGGAAGGGVGGAHALMNARNAAKKKKKSQEKRQESKAAKTL 719
            |.||.:.|...|.:...........|.......|...|..|:::.:   .:....::|:|..:||
  Fly   481 RHSHGERDRERLRSHHHHPHYHHQAGVTTTSTSGNTSANTNSKSLS---NRITSLKKENKTTQTL 542

  Fly   720 SAILLSFIITWTPYNILVLIKPLTT---CSDCIPTEL-WDFFYALCYINSTINPMCYALCNATFR 780
            |.::..||..|.|:.|..||.|...   .|..:...| |     |.:.||.|||..||..:..||
  Fly   543 SIVVGGFIACWLPFFINYLITPFLAEHQASQMLAKALTW-----LGWFNSAINPFIYAFYSVDFR 602

  Fly   781 RTYVRILTCK 790
            ..:.| ||||
  Fly   603 AAFWR-LTCK 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 54/125 (43%)
7tm_1 121..>314 CDD:278431 66/194 (34%)
TyrRNP_001287381.1 7tm_4 127..>249 CDD:304433 53/122 (43%)
7tm_1 133..>298 CDD:278431 65/171 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123107465
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.