DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and CG13579

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_001261169.1 Gene:CG13579 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster

Alignment Length:746 Identity:147/747 (20%)
Similarity:236/747 (32%) Gaps:215/747 (29%)


  Fly    97 PRYS----LASMVVMGFVAAILSTVTVAG----NVMVMISFKIDKQ-----LQTISNYFLFSLAI 148
            ||||    :|.:.:...:.|:|..|...|    |.:|:  |.|:.:     :.....|.|.|||:
  Fly    22 PRYSGHNFIAHIGIAETIEAVLILVLTLGVIGANCLVI--FVINNRRYAAYIHQQPRYLLTSLAL 84

  Fly   149 ADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYR 213
            .|..||.:..|...:..:...||.|.|.|.....|....|..|.:.|:.::.|||.....|..|.
  Fly    85 NDLTIGLLITPFGLMPALFHCWPYGEIFCQIQALLRGALSQQSAVILVCMAVDRYMCALHPRRYY 149

  Fly   214 AKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQ--------FIETNQYITF 270
            ...:......::...|.|||.::           |...:||...:..        |.....|...
  Fly   150 QHSSKKGCVAILSLTWIISLTVF-----------GFLVLPKGYYFNNTGLMACEPFYSKPSYRIL 203

  Fly   271 GTALAAFYFPVT-IMCFLYWRIWRETKKRQKD--LPNLQAGKKDSSKRSNSSDENTVV-----NH 327
            .|  .|.|||.| ::.:.|...:..::.|..|  :|...|..........::.:...:     :|
  Fly   204 ST--CALYFPTTMVLMYCYGSSFHMSRFRLNDPTMPLTAAAHHPHPHPHPTAAQQLQMHQHQQHH 266

  Fly   328 ASGGLLAFAQVGGNDHDTWRRPRSESSPDAESVY------------MTNMVIDSGYHGMHSRKSS 380
            ...|:.:....|.:.|     |...|.|:..:.:            ..:|.:..|..||.:    
  Fly   267 QQAGMHSHLYHGHSHH-----PSHPSHPNHPNHHGHPHHHGPPVMGHLSMAMSMGLAGMPN---- 322

  Fly   381 IKSTNTIKKSYTCFGSIKEWCIAWWHSGREDSDDFAYEQEEPSDLGYATPVTIETPLQSSVSRCT 445
              .||.|.|...   .|:|          ::|............||:...||..| :|..|:.||
  Fly   323 --MTNKITKKIV---PIQE----------KNSSGSTSRSMAAISLGFIVMVTPWT-IQEIVTACT 371

  Fly   446 S------MNVMRDNYSMGGSV----------SGVRPPS-----------------------ILLS 471
            .      ::.:....::..|:          |..|..|                       |..:
  Fly   372 GSKLPPFLDFLVTWTALSNSLWNPFMYWLLNSDFRRMSRQLMPNKCFPHEDTPEHKSGCCHINAN 436

  Fly   472 DVSPTPLPRPPLASISQLQEMSAVTASTTANVNTSGNGNGAINNNNNASHNGNGAVNGNGAGNGS 536
            |...|.||.||....|:               ...|.|.|....::....:|.|..:..|   ||
  Fly   437 DFEITTLPIPPEPPSSR---------------PPGGAGGGGGGPSSGGPSSGGGVASSIG---GS 483

  Fly   537 GIGL------------------GTTGNATHRD------SRTLPVINRINSRSVSQDSVYTILIRL 577
            .:|:                  ||.|...|..      |.|.|.|..::.:...:     ||.|.
  Fly   484 VLGICGRSRTNSLSRSASQYIRGTMGGGVHNHQATETFSTTRPDIEGLSEKYWGE-----ILERT 543

  Fly   578 PSDGASSNAANGGGGGPGAGAAASASLSMQGDCAPSI-------------KMIHEDGPTTTAAAA 629
            .|.| :.||                   ||....|.:             :..|:...|:.:.|:
  Fly   544 VSSG-NLNA-------------------MQKHLPPHLPYAHHLVHQIHQPQQHHQQQTTSFSKAS 588

  Fly   630 PL-----ASAAATRRPLPSRDSEFSLPLGRRMSHAQHDARLLNAKVI---PKQLGKAGGGAAGGG 686
            .|     .|.|||...|    .:||....:...|..||.....:|..   .:..||...|.:...
  Fly   589 DLQLNLNLSQAATAAEL----GKFSNSEPKLCEHLFHDVNCAKSKAANGDGESSGKLACGRSIPD 649

  Fly   687 VGGAHALMNARN---AAKKKKKSQEKRQESK 714
            : .|..::.|:|   |.:.|.......|::|
  Fly   650 IXYAEDVILAKNQLLARQAKCSHHPLHQQAK 680

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 33/133 (25%)
7tm_1 121..>314 CDD:278431 48/213 (23%)
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123106607
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.