DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and 5-HT1A

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_001356890.1 Gene:5-HT1A FlyBaseID:FBgn0004168 Length:846 Species:Drosophila melanogaster

Alignment Length:862 Identity:208/863 (24%)
Similarity:325/863 (38%) Gaps:224/863 (26%)


  Fly     3 PVMSLALAAHGPPSILEPLFKTVTTSTT--TTTTTTTSTTTTTASPA-----------GYSPGYP 54
            |:.:.||||....:.:......:|....  ..||...:|::..:|||           ..:.|. 
  Fly   106 PLATAALAAAAASASVAAAAARITAKAAHRALTTKQDATSSPASSPALQLIDMDNNYTNVAVGL- 169

  Fly    55 GTTLL--TALFENLTSTAASGLYDPYSGMYGNQTNGTIGFETKGPRYS------LASMVVMGFVA 111
            |..||  |.|.|...|:....:....||.. :..|||.|......:.:      |..|.|...:.
  Fly   170 GAMLLNDTLLLEGNDSSLFGEMLANRSGQL-DLINGTGGLNVTTSKVAEDDFTQLLRMAVTSVLL 233

  Fly   112 AILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAVTTILGYWPLGPIV 176
            .::..||:.|||.|:.:..:::.||.::||.:.|||:||..:..:.|||.||..|...|.|||.:
  Fly   234 GLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPEL 298

  Fly   177 CDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAWGISLLLWPPWIY 241
            ||.|.:.|.|...||:|:|:.|:.|||::||. :.|...||:||..:||...|..::::.....:
  Fly   299 CDIWTSCDVLCCTASILHLVAIAVDRYWAVTN-IDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQF 362

  Fly   242 SWPYIEGKRTVPKDECYIQFIETNQ--------YITFGTALAAFYFPVTIMCFLYWRIWRETKK- 297
            .|          ||..|:|.||..:        |..|.|. ..||.|:.::..|||:|::..:| 
  Fly   363 GW----------KDPDYLQRIEQQKCMVSQDVSYQVFATC-CTFYVPLLVILALYWKIYQTARKR 416

  Fly   298 --RQKDLP-----------------------NLQAGKKDSSKRSNSSDENTVVNHASGGLLAFAQ 337
              |::..|                       .|:.|:..::| |.:.....|...|||| .|...
  Fly   417 IHRRRPRPVDAAVNNNQPDGGAATDTKLHRLRLRLGRFSTAK-SKTGSAVGVSGPASGG-RALGL 479

  Fly   338 VGGNDHDTWRRPR----SESSPDAESVYMTNMVIDSG------YHGMHSRKSSIKSTNTIKKSYT 392
            |.||..:|.....    |.|:.|::|.........||      .|.:...|...||  |.|.|..
  Fly   480 VDGNSTNTVNTVEDTEFSSSNVDSKSRAGVEAPSTSGNQIATVSHLVALAKQQGKS--TAKSSAA 542

  Fly   393 CFGSIKEWCIAWWHSGREDSDDFAYEQEEPSD----------LGYATPVTIETPLQSSVSRCTSM 447
            ..|...        |||::.|....|..|..|          :| ..|.|     .:|.......
  Fly   543 VNGMAP--------SGRQEDDGQRPEHGEQEDREELEDQDEQVG-PQPTT-----ATSAMTAAGT 593

  Fly   448 NVMRDNYSMGGSVSGVRPPSILLSDVSPTPLPRPPLASISQLQEMSAVTASTTANVNTSGNGNGA 512
            |...|.....|            .:|...|..:..|..:.|||:..           .||.|.||
  Fly   594 NESEDQCKANG------------VEVLEDPQLQQQLEQVQQLQKSV-----------KSGGGGGA 635

  Fly   513 INNNNNASHNGNGAVNGNGAGNGSGIGLGTTGNATHRDSRTLPVINRINSRSVSQDSVYTILIRL 577
                                         :|.|||     |:..|:.::.::.:..         
  Fly   636 -----------------------------STSNAT-----TITSISALSPQTPTSQ--------- 657

  Fly   578 PSDGASSNAANGGGGGPGAGAAASASLSMQGDCAPSIKMIHEDGPTT-TAAAAPLASAAATRRPL 641
                           |.|..|||:..::.:.....|....|   |.. ||..:|......:|:|.
  Fly   658 ---------------GVGIAAAAAGPMTAKTSTLTSCNQSH---PLCGTANESPSTPEPRSRQPT 704

  Fly   642 PSRDSEFSLPLGRRMSHAQHDARLLNAKVIPKQLGKAGGGAAGGGVGGAHALMNARNAAKKKKKS 706
            ..:...      .:.:|.|...:        :||.               ::.|......|:|::
  Fly   705 TPQQQP------HQQAHQQQQQQ--------QQLS---------------SIANPMQKVNKRKET 740

  Fly   707 QEKRQESKAAKTLSAILLSFIITWTPYNILVLIKPLTTCSDC-IPTELWDFFYALCYINSTINPM 770
            .|.::|.||||||:.|..:|::.|.|:.::.|..||  |:.| |...:...|..|.|.|||:||:
  Fly   741 LEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPL--CAACQISDSVASLFLWLGYFNSTLNPV 803

  Fly   771 CYALCNATFRRTYVRIL 787
            .|.:.:..||:.:.|||
  Fly   804 IYTIFSPEFRQAFKRIL 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 48/124 (39%)
7tm_1 121..>314 CDD:278431 68/227 (30%)
5-HT1ANP_001356890.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24247
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.