DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and Dop2R

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_001014758.2 Gene:Dop2R FlyBaseID:FBgn0053517 Length:905 Species:Drosophila melanogaster

Alignment Length:790 Identity:175/791 (22%)
Similarity:290/791 (37%) Gaps:241/791 (30%)


  Fly    36 TTSTTTTTASPAGYSPGYPGTTLLTALFENLTSTAASGLYDPYSGMYGNQTNGTIGFETKGPRYS 100
            :|.:.|:|.:|.....|..|:.||  |.:|||     |||  ..|...|.||.|:..........
  Fly   316 STVSGTSTIAPGVAITGSRGSGLL--LEQNLT-----GLY--LDGYRLNCTNETLNLTDSCGELR 371

  Fly   101 LASMVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAVTT 165
            :........:..:...:|:.||::|::|...::.|||::|||:.||||||..:..:.||......
  Fly   372 VVDHNYWALILILFPILTLFGNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFL 436

  Fly   166 ILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAWG 230
            :.|.|.|..:|||.::|:|.:.|.:|:.||:.||.|||.:||:|:.|...:.:.|..:.|...|.
  Fly   437 VNGAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWA 501

  Fly   231 ISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVTIMCFLYWRIWRET 295
            ||..:      ..|.:.|....|..|..:.......:|.: ::|::||.|..||.||||.|::..
  Fly   502 ISAAI------GSPIVLGLNNTPNREPDVCAFYNADFILY-SSLSSFYIPCIIMVFLYWNIFKAL 559

  Fly   296 KKRQKDLPNLQAGKKDSSKRSNSSDENTVVNHASGGLLAFAQVGGNDHDTWRRPRSESSPDAESV 360
            :.|        |.|:.::::.:.|:       .:||                   |.....|::.
  Fly   560 RSR--------ARKQRAARKPHLSE-------LTGG-------------------SVIENIAQTR 590

  Fly   361 YMTNMVIDSGYHGMHSRKSSIKSTNTIKKSYTCFGSIKEWCIAWWHSGREDSDDFAYEQEEPSDL 425
            .:....:||..|........ .:|||.                   ||..:.:|           
  Fly   591 RLAETALDSSRHASRILPDE-AATNTA-------------------SGSNEEED----------- 624

  Fly   426 GYATPVTIETPLQSSVSRCTSMNVMRDNYSMGGSVSGVRPPSILLSDVSPTPLPRPPLASISQLQ 490
                    |..:...:..|                      .::::|.|...:    ||::.:..
  Fly   625 --------ENAISPDIDDC----------------------HVIVNDKSTEFM----LATVVEET 655

  Fly   491 EMSAVTASTTAN--VNTSGNGNGAINNNNNASHNGNGAVNGNGAGNGSGIGLGTTGNATHRDSRT 553
            ..|.|...||..  |....|||                                           
  Fly   656 GNSVVAQITTQPQLVVADPNGN------------------------------------------- 677

  Fly   554 LPVINRINSRSVSQDSVYTILIRLPSDGASSNAANGGGGGPGAGAAASASLSMQGDCAPSIKMIH 618
                         .||.|          |:||..:...|...|.|:|:.|.:.:...:|      
  Fly   678 -------------HDSGY----------AASNVDDVLAGVAPASASAATSAAPRSSGSP------ 713

  Fly   619 EDGPTTTAAAAPLASAAATRRPL----PSR-----------DSEFSL-PLG-------RRMSHAQ 660
            .|.|..:.|....:|.::.|||.    |.|           :|..:: ||.       ..|:.|:
  Fly   714 PDSPLPSGATLQRSSVSSQRRPTGDDSPKRGEPALRSVGVDNSSVAMKPLSFVRYGVQEAMTLAR 778

  Fly   661 HDARLLNAKVIPKQLGKAGGGAAGGGVGGAHALMNARNAAKKKKKSQEKRQESKAAKTLSAILLS 725
            :|:.|........:..|....|:      ...:.....|:|||::....::|.||.|||:.:|..
  Fly   779 NDSTLSTTSKTSSRKDKKNSQAS------RFTIYKVHKASKKKREKSSAKKERKATKTLAIVLGV 837

  Fly   726 FIITWTPY---NILVLIKPLTTCS----DCIP------TELWDFFYALCYINSTINPMCYALCNA 777
            |:..|.|:   ||:..:     |:    ||.|      ...|     |.||||.:||:.|.:.|.
  Fly   838 FLFCWLPFFSCNIMDAM-----CAKFKKDCRPGLTAYMMTTW-----LGYINSFVNPVIYTIFNP 892

  Fly   778 TFRRTYVRIL 787
            .||:.:.:|:
  Fly   893 EFRKAFKKIM 902

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 45/124 (36%)
7tm_1 121..>314 CDD:278431 63/193 (33%)
Dop2RNP_001014758.2 7tmA_D2-like_dopamine_R 376..>565 CDD:320181 63/204 (31%)
TM helix 1 377..403 CDD:320181 5/26 (19%)
TM helix 2 410..436 CDD:320181 11/26 (42%)
TM helix 3 448..478 CDD:320181 14/30 (47%)
TM helix 4 490..513 CDD:320181 6/29 (21%)
TM helix 5 529..558 CDD:320181 12/30 (40%)
7tm_GPCRs <822..898 CDD:333717 28/86 (33%)
TM helix 6 825..850 CDD:320095 10/25 (40%)
TM helix 7 866..891 CDD:320095 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123105141
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.