DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and Hrh1

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:XP_017447930.1 Gene:Hrh1 RGDID:2830 Length:542 Species:Rattus norvegicus

Alignment Length:761 Identity:161/762 (21%)
Similarity:257/762 (34%) Gaps:275/762 (36%)


  Fly    53 YPG----------TTLLTALFENLTSTAASGLYDPYSGMYGNQTNGTIGFETK---GPRYSLASM 104
            :||          ..|:...|.|.:||                      ||.|   |.|.::||.
  Rat    39 FPGAGSGREPSLEAALVPMSFANTSST----------------------FEDKMCEGNRTAMASP 81

  Fly   105 VVMGFVAAI--LSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISMPLFAVTTIL 167
            .::..|..:  :|.|||..|::|:.:...:::|.|:.|.::.||::||..:||:.||:..:..|:
  Rat    82 QLLPLVVVLSSISLVTVGLNLLVLYAVHSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLIM 146

  Fly   168 GYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAWGIS 232
            ..|.||..:|..||::||:||.||:.::.|:..|||.||.:||.|...||..||:..|..||..|
  Rat   147 TKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLRYRTKTRASATILGAWFFS 211

  Fly   233 LLLWPPWIYSW-PYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVTIMCFLYWRIWRETK 296
             .||...|..| .::.....:.:|:|...|.... :....||:..||.|..:|.:.|.:|::..:
  Rat   212 -FLWVIPILGWHHFMPPAPELREDKCETDFYNVT-WFKIMTAIINFYLPTLLMLWFYVKIYKAVR 274

  Fly   297 K--RQKDLPNLQAGKKDSSKRSNSSDENTVVNHASGGLLAFAQVGGNDHDTWRRPRSESSPDAES 359
            :  :.:.|.|                         |.|.:|:::.....||   ......|..||
  Rat   275 RHCQHRQLTN-------------------------GSLPSFSELKLRSDDT---KEGAKKPGRES 311

  Fly   360 VYMTNMVIDSGYHGMHSRKSSIKSTNTIKKSYTCFGSIKEWCIAWWHSGREDSDDFAYEQEEPSD 424
            .:           |:..|.|...|....:||                           ..|:|. 
  Rat   312 PW-----------GVLKRPSRDPSVGLDQKS---------------------------TSEDPK- 337

  Fly   425 LGYATPVTIETPLQSSVSRCTSMNVMRDNYSMGGSVSGVRPPSILLSDVSPTPLPRPPLASISQL 489
              ..:|.......:.....|..:::|:......|.|.|        |..:...|.:|.:      
  Rat   338 --MTSPTVFSQEGERETRPCFRLDIMQKQSMAEGDVRG--------SKANDQALSQPKM------ 386

  Fly   490 QEMSAVTASTTANVNTSGNGNGAINNNNNASHNGNGAVNGNGAGNGSGIGLGTTGNATHRDSRTL 554
                                                                        |.::|
  Rat   387 ------------------------------------------------------------DEQSL 391

  Fly   555 PVINRINSRSVSQDSVYTILIRLPSDGASSNAANGGGGGPGAGAAASASLSMQGDCAPSIKMIHE 619
            ....||:..|..|..|                             ...|.|...|...||    |
  Rat   392 NTCRRISETSEDQTLV-----------------------------DQQSFSRTTDSDTSI----E 423

  Fly   620 DGPTTTAAAAPLASAAATRRPLPSRDSEFSLPLGRRMSHAQHDARLLNAKVIPKQLGKAGGGAAG 684
            .||                              ||..|.:..::.|...|:..|:|         
  Rat   424 PGP------------------------------GRVKSRSGSNSGLDYIKITWKRL--------- 449

  Fly   685 GGVGGAHALMNARNAAKKKKKSQEKRQESKAAKTLSAILLSFIITWTPYNILVLIKPLTTCSDCI 749
                        |:.:::........:|.||||.|..|:.:||:.|.||.|..::  :..|..|.
  Rat   450 ------------RSHSRQYVSGLHLNRERKAAKQLGFIMAAFILCWIPYFIFFMV--IAFCKSCC 500

  Fly   750 PTELWDFFYALCYINSTINPMCYALCNATFRRTYVRILTCKWHTRN 795
            ...:..|...|.|||||:||:.|.|||..|::|:.:||    |.|:
  Rat   501 SEPVHMFTIWLGYINSTLNPLIYPLCNENFKKTFKKIL----HIRS 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 49/124 (40%)
7tm_1 121..>314 CDD:278431 60/196 (31%)
Hrh1XP_017447930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.