DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and Chrm2

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_987076.2 Gene:Chrm2 MGIID:88397 Length:466 Species:Mus musculus

Alignment Length:733 Identity:222/734 (30%)
Similarity:291/734 (40%) Gaps:295/734 (40%)


  Fly    84 NQTNGT-IGFETKGPRYSLASMVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLA 147
            |.||.: .|.....| |....:|.:..||..||.||:.||::||:|.|:::.|||::||||||||
Mouse     3 NSTNSSNNGLAITSP-YKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLA 66

  Fly   148 IADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTY 212
            .||..||..||.|:.:.|::|||||||:|||.||||||:.|||||:|||||||||||.||:||||
Mouse    67 CADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTY 131

  Fly   213 RAKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAF 277
            ..||||..|.:||.|||.:|.:||.|.|..|.:|.|.|||...||||||. :|..:|||||:|||
Mouse   132 PVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFF-SNAAVTFGTAIAAF 195

  Fly   278 YFPVTIMCFLYWRIWRETKKRQKDLPNLQAGKKDSSKRSNSSDENTVVNHASGGLLAFAQVGGND 342
            |.||.||..|||.|.|.:|.|                                            
Mouse   196 YLPVIIMTVLYWHISRASKSR-------------------------------------------- 216

  Fly   343 HDTWRRPRSESSPDAESVYMTNMVIDSGYHGMHSRKSSIKSTNTIKKSYTCFGSIKEWCIAWWHS 407
                                                        |||                  
Mouse   217 --------------------------------------------IKK------------------ 219

  Fly   408 GREDSDDFAYEQEEPSDLGYATPVTIETPLQSSVSRCTSMNVMRDNYSMGGSVSG--VRPPSILL 470
                      |::|        ||..:.|:..|:                  |.|  |:|     
Mouse   220 ----------EKKE--------PVANQDPVSPSL------------------VQGRIVKP----- 243

  Fly   471 SDVSPTPLPRPPLASISQLQEMSAVTASTTANVNTSGNGNGAINNNNNASHNGNGAVNGNGAGNG 535
                                                         |||....|:|.:..|...||
Mouse   244 ---------------------------------------------NNNNMPGGDGGLEHNKIQNG 263

  Fly   536 SGIGLGTTGNATHRDSRTLPVINRINSRSVSQDSVYTILIRLPSDGASSNAANGGGGGPGAGAAA 600
                                                    :.|.||.:.|...|           
Mouse   264 ----------------------------------------KAPRDGGTENCVQG----------- 277

  Fly   601 SASLSMQGDCAPSIKMIHEDGPTTTAAAAPLASAAATRRPLPSRDSEFSL---PLGRRMSHAQHD 662
                        ..|....|..:.:|.|:.:            ||.|.:.   .:...:.|::.|
Mouse   278 ------------EEKESSNDSTSVSAVASNM------------RDDEITQDENTVSTSLGHSKDD 318

  Fly   663 -ARLLNAKVIPK-QLGKAGG---------GAAGGGVGGAHALMNARNAAKKKKKSQEKR----QE 712
             :|....|::.| |.|.|..         |::|.. |.....:.||...|..|:..:|:    :|
Mouse   319 NSRQTCIKIVTKTQKGDACTPTSTTVELVGSSGQN-GDEKQNIVARKIVKMTKQPAKKKPPPSRE 382

  Fly   713 SKAAKTLSAILLSFIITWTPYNILVLIKPLTTCSDCIPTELWDFFYALCYINSTINPMCYALCNA 777
            .|..:|:.||||:|||||.|||::|||.  |.|:.|||..:|...|.||||||||||.|||||||
Mouse   383 KKVTRTILAILLAFIITWAPYNVMVLIN--TFCAPCIPNTVWTIGYWLCYINSTINPACYALCNA 445

  Fly   778 TFRRTYVRILTCKWHTRN 795
            ||::|:..:|.|  |.:|
Mouse   446 TFKKTFKHLLMC--HYKN 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 80/124 (65%)
7tm_1 121..>314 CDD:278431 111/193 (58%)
Chrm2NP_987076.2 7tmA_mAChR_M2 24..451 CDD:320424 212/698 (30%)
TM helix 1 25..51 CDD:320424 12/26 (46%)
TM helix 2 58..84 CDD:320424 15/26 (58%)
TM helix 3 96..126 CDD:320424 25/30 (83%)
Agonist binding. {ECO:0000250} 103..107 2/4 (50%)
Important for signaling 120..122 2/2 (100%)
TM helix 4 138..161 CDD:320424 11/23 (48%)
TM helix 5 183..212 CDD:320424 19/29 (66%)
TM helix 6 380..410 CDD:320424 18/30 (60%)
Agonist binding. {ECO:0000250} 403..404 1/1 (100%)
TM helix 7 419..444 CDD:320424 17/25 (68%)
Agonist binding. {ECO:0000250} 426..430 3/4 (75%)
Important for signaling 436..440 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000316
OrthoInspector 1 1.000 T615615
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24247
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.870

Return to query results.
Submit another query.