DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and CHRM4

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_000732.2 Gene:CHRM4 HGNCID:1953 Length:479 Species:Homo sapiens

Alignment Length:726 Identity:223/727 (31%)
Similarity:305/727 (42%) Gaps:260/727 (36%)


  Fly    75 YDPYSGMYGNQTNGTIGFETKGPRYSLASMVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTIS 139
            :.|.:|..|||:...:...:.. ||....||.:..|...||.|||.||::||:|.|:::||||::
Human     4 FTPVNGSSGNQSVRLVTSSSHN-RYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNRQLQTVN 67

  Fly   140 NYFLFSLAIADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYF 204
            ||||||||.||..|||.||.|:.|..|.||||||.:|||.||||||:.|||||:|||||||||||
Human    68 NYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVMNLLIISFDRYF 132

  Fly   205 SVTRPLTYRAKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYIT 269
            .||:||||.|:|||..|.:||.|||.:|.:||.|.|..|.::.||||||.::|:|||: :|..:|
Human   133 CVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVPDNQCFIQFL-SNPAVT 196

  Fly   270 FGTALAAFYFPVTIMCFLYWRIWRETKKR-QKDLPNLQAGKKDSSKRSNSSDENTVVNHASGGLL 333
            ||||:||||.||.||..||..|...::.| .|..|.   |.|:...::                |
Human   197 FGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPE---GPKEKKAKT----------------L 242

  Fly   334 AFAQVGGNDHDTWRRPRSESSPDAESVYMTNMVIDSGYHGMHSRKSSIKSTNTIKKSYTCFGSIK 398
            ||.:                ||                    ..|.|:|                
Human   243 AFLK----------------SP--------------------LMKQSVK---------------- 255

  Fly   399 EWCIAWWHSGREDSDDFAYEQEEPSDLGYATPVTIETPLQSSVSRCTSMNVMRDNYSMGGSV--- 460
                      :....:.|.|:.....|..|.|..:..|.:....:.||      |.|..||.   
Human   256 ----------KPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTS------NESSSGSATQN 304

  Fly   461 SGVRPPSILLSDVSPTP-LPRPPLASISQLQEMSAVTASTTANVNTSGNGNGAINNNNNASHNGN 524
            :..||.:.|.:..:.|| :|.|||    |.:.::..:..:...:.|...||              
Human   305 TKERPATELSTTEATTPAMPAPPL----QPRALNPASRWSKIQIVTKQTGN-------------- 351

  Fly   525 GAVNGNGAGNGSGIGLGTTGNATHRDSRTLPVINRINSRSVSQDSVYTILIRLPSDGASSNAANG 589
                                                                             
Human   352 ----------------------------------------------------------------- 351

  Fly   590 GGGGPGAGAAASASLSMQGDCAPSIKMIHEDGPTTTAAAAPLASAAATRRPLPSRDSEFSLPLGR 654
                               :|..:|:::    |.|.|...|.|:.|                  |
Human   352 -------------------ECVTAIEIV----PATPAGMRPAANVA------------------R 375

  Fly   655 RMSHAQHDARLLNAKVIPKQLGKAGGGAAGGGVGGAHALMNARNAAKKKKKSQEKRQESKAAKTL 719
            :.:..                                    |||..:||:  |...:|.|..:|:
Human   376 KFASI------------------------------------ARNQVRKKR--QMAARERKVTRTI 402

  Fly   720 SAILLSFIITWTPYNILVLIKPLTTCSDCIPTELWDFFYALCYINSTINPMCYALCNATFRRTYV 784
            .||||:||:||||||::||:.  |.|..|||..:|...|.|||:||||||.|||||||||::|:.
Human   403 FAILLAFILTWTPYNVMVLVN--TFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFR 465

  Fly   785 RILTCKWHTRN 795
            .:|.|::  ||
Human   466 HLLLCQY--RN 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 83/124 (67%)
7tm_1 121..>314 CDD:278431 113/194 (58%)
CHRM4NP_000732.2 7tmA_mAChR_M4 33..464 CDD:320425 211/683 (31%)
TM helix 1 34..60 CDD:320425 12/26 (46%)
TM helix 2 67..93 CDD:320425 17/26 (65%)
TM helix 3 105..135 CDD:320425 25/30 (83%)
TM helix 4 147..170 CDD:320425 11/23 (48%)
TM helix 5 192..221 CDD:320425 17/29 (59%)
TM helix 6 393..423 CDD:320425 17/30 (57%)
TM helix 7 432..457 CDD:320425 16/25 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4220
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 385 1.000 Inparanoid score I2014
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608787
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24247
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.