DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mAChR-A and chrm5

Sequence 1:NP_523844.2 Gene:mAChR-A FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:XP_017952476.1 Gene:chrm5 XenbaseID:XB-GENE-986590 Length:525 Species:Xenopus tropicalis

Alignment Length:730 Identity:230/731 (31%)
Similarity:314/731 (43%) Gaps:246/731 (34%)


  Fly    84 NQTNGTIGFETKGPRYSLASMVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAI 148
            |.:|||:..:.    :||..::.:..|:||:|.:|:.||::||:|||::.||:|::||:|.|||.
 Frog     9 NNSNGTVPLKA----HSLWEVITIATVSAIVSLITIVGNILVMVSFKVNSQLKTVNNYYLLSLAC 69

  Fly   149 ADFAIGAISMPLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYR 213
            ||..||..||.|:....::|:|.||.:.||.||||||:||||||:|||:||||||||:|||||||
 Frog    70 ADLIIGIFSMNLYTSYILIGHWSLGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYR 134

  Fly   214 AKRTTNRAAVMIGAAWGISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFY 278
            ||||..||.:|||.||.||.:||.|.|..|.|..|.||||.:||.|||: ....||||||:||||
 Frog   135 AKRTPKRAGLMIGLAWFISFILWAPAILCWQYFVGGRTVPPEECQIQFL-YEPIITFGTAIAAFY 198

  Fly   279 FPVTIMCFLYWRIWRETKKRQKDLPNLQAGKKDSSKRSNSSDENTVVNHASGGLLAFAQVGGNDH 343
            .||::|..||.||::||:||.|||..||.                                    
 Frog   199 LPVSVMTILYCRIYKETEKRTKDLAELQG------------------------------------ 227

  Fly   344 DTWRRPRSESSPDAESVYMTNMVIDSGYHGMHSRKSSIKSTNTIKKSYTCFG------SIKEWCI 402
                   |||..|.|                     .::...|:.||  ||.      :.:|.|.
 Frog   228 -------SESVADFE---------------------MMRPQGTLFKS--CFSCKQQTRTKRERCQ 262

  Fly   403 AWWHSGREDSDDFAYEQEEPSDLGYATPVTIETPLQSSVSRCTSMNVMRDNYSMGGSVSGVRPPS 467
            |.|                                 ||.||.|:..|                  
 Frog   263 ASW---------------------------------SSSSRSTTTTV------------------ 276

  Fly   468 ILLSDVSPTPLPRPPLASISQLQEMSAVTASTTANVNT-SGNGNGAINNNNNASHNGNGAVNGNG 531
                .::.:|..........||...|:..:|...:..| .....||..|...|            
 Frog   277 ----KITHSPNTCNEWIKEDQLTTCSSYPSSDDEDKQTKEAVFQGAYENQTEA------------ 325

  Fly   532 AGNGSGIGLGTTGNATHRDSRTLPVINRINSRSVSQDSVYTILIRLPSDGASSNAANGGGGGPGA 596
                            .::..|..::.:......:.:|....|.                  ||.
 Frog   326 ----------------QKEEETKQILTKEQPGLSNYESERFFLT------------------PGK 356

  Fly   597 GAAASASLSMQGDCAPSIK---MIHEDGPTTT------AAAAPLASAAATRRPLPSRDSEFSLPL 652
            |.      |.:.....|.|   ::::||....      ....|.:|                   
 Frog   357 GH------SQKSPKCVSYKFRIVVNDDGSQEVNNGCRKVKITPCSS------------------- 396

  Fly   653 GRRMSHAQHDARLLNAKVIPKQLGKAGGGAAGGGVGGAHALMNARNAAKKKKKSQEKRQESKAAK 717
               ||.. |..|.::..:                   :|.:        .|:|.....:|.|||:
 Frog   397 ---MSKG-HSLRSMDPSI-------------------SHQI--------TKRKRMVLIKERKAAQ 430

  Fly   718 TLSAILLSFIITWTPYNILVLIKPLTTCSDCIPTELWDFFYALCYINSTINPMCYALCNATFRRT 782
            |||||||:||||||||||:||:.  |.||||||:.||...|.|||:|||:||:||||||.|||:|
 Frog   431 TLSAILLAFIITWTPYNIMVLVS--TFCSDCIPSSLWHLGYWLCYVNSTVNPICYALCNKTFRKT 493

  Fly   783 YVRILTCKWHTRNRE 797
            :..:|.|:|..:..|
 Frog   494 FKMLLLCRWRKKTVE 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 77/124 (62%)
7tm_1 121..>314 CDD:278431 114/193 (59%)
chrm5XP_017952476.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4220
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 386 1.000 Inparanoid score I1859
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000316
OrthoInspector 1 1.000 T600701
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2382
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.