DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cN-IIIB and EIF5B

Sequence 1:NP_611895.1 Gene:cN-IIIB FlyBaseID:FBgn0034988 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_056988.3 Gene:EIF5B HGNCID:30793 Length:1220 Species:Homo sapiens

Alignment Length:86 Identity:20/87 (23%)
Similarity:36/87 (41%) Gaps:19/87 (22%)


  Fly   233 LVHTRDHIIVMGDSIGDADMASGVP---ASSHIMKIGFLFDHVEANMKKYMDTFDIVLVDDQTMD 294
            :.::||. ||||.::....:..|.|   .|.:.:.|| :...:|.|.|:              :|
Human  1101 IFNSRDP-IVMGVTVEAGQVKQGTPMCVPSKNFVDIG-IVTSIEINHKQ--------------VD 1149

  Fly   295 VPRTLLSLIEKQHKLNLEAPK 315
            |.:....:..|...:..|:||
Human  1150 VAKKGQEVCVKIEPIPGESPK 1170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cN-IIIBNP_611895.1 HAD-SF-IE 22..303 CDD:273683 16/73 (22%)
EIF5BNP_056988.3 DTHCT 110..>171 CDD:285332
PRK04004 627..1202 CDD:235195 20/87 (23%)
IF2_eIF5B 632..845 CDD:206674
G1. {ECO:0000255|PROSITE-ProRule:PRU01059} 638..645
G2. {ECO:0000255|PROSITE-ProRule:PRU01059} 663..667
G3. {ECO:0000255|PROSITE-ProRule:PRU01059} 702..705
G4. {ECO:0000255|PROSITE-ProRule:PRU01059} 756..759
G5. {ECO:0000255|PROSITE-ProRule:PRU01059} 824..826
aeIF5B_II 855..965 CDD:293904
IF-2 966..1067 CDD:288813
IF2_aeIF5B_IV 1092..1186 CDD:293911 20/87 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1171042at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.