DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cN-IIIB and AT2G38680

Sequence 1:NP_611895.1 Gene:cN-IIIB FlyBaseID:FBgn0034988 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001318374.1 Gene:AT2G38680 AraportID:AT2G38680 Length:344 Species:Arabidopsis thaliana

Alignment Length:291 Identity:96/292 (33%)
Similarity:148/292 (51%) Gaps:37/292 (13%)


  Fly    21 ALTQDHCRMRDPAEVERIINEFVIGGPERMQIVSDFDYTITKQRTEDGGAVPSSFGIFNACQSLP 85
            |||.....:||             .||.:.|:::|||.|:|:.|........:|.|:.   |...
plant    57 ALTDKMTLIRD-------------AGPSKFQVIADFDATLTRYRVNGLRGRQTSHGLL---QQGD 105

  Fly    86 ENFKAETDKLYHKYRPIEIDPHMPIAEKVQYMIEWWTKSGEL--TSGFPFDQSEIDQIASKYTHA 148
            ..:.|:...||..|.|:||.|.:||.||.:.|.|||.|:.||  ..|..:|  .|.:..:..:.|
plant   106 AYYDAKRQALYDHYHPLEISPVIPIDEKTKLMEEWWGKTHELLIEGGLTYD--AIKKSVANSSIA 168

  Fly   149 LRDRTHEFFADLQRLGIPTLVFSAGLGNSVVSVLRQ-ANVLHPNVKVVSNFLQFR-DGLLDGFQQ 211
            .|:...|.|..|::..||.|:|||||.:.:..|||| .:....|||:|||.:.|. ||.|..|:.
plant   169 FREGVSELFEFLEKKEIPVLIFSAGLADVIEEVLRQNLDRTFKNVKIVSNRMVFNDDGQLVSFKG 233

  Fly   212 PMIHTFNKNETVLNETSEYYDL--------------VHTRDHIIVMGDSIGDADMASGVPASSHI 262
            .:||..||||..|:..:..:|.              :..|.::::|||.:||..|:.|:...:.|
plant   234 KLIHVLNKNEHALDMAAPLHDRLGVDIGEEDEENVNMKERRNVLLMGDHLGDLRMSDGLDYETRI 298

  Fly   263 MKIGFLFDHVEANMKKYMDTFDIVLVDDQTM 293
             .||||.|::|.:::.|.::||:|.::|..|
plant   299 -SIGFLNDNIEKSLESYRESFDLVYLNDAPM 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cN-IIIBNP_611895.1 HAD-SF-IE 22..303 CDD:273683 95/291 (33%)
AT2G38680NP_001318374.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41684
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1171042at2759
OrthoInspector 1 1.000 T192933
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13045
Phylome 00.000 Not matched by this tool.
66.120

Return to query results.
Submit another query.