DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cN-IIIB and AT2G38680

DIOPT Version :10

Sequence 1:NP_611895.1 Gene:cN-IIIB / 37875 FlyBaseID:FBgn0034988 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001318374.1 Gene:AT2G38680 / 818450 AraportID:AT2G38680 Length:344 Species:Arabidopsis thaliana


Alignment Length:68 Identity:15/68 - (22%)
Similarity:29/68 - (42%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RSQSLANLPYQVTASSNVYGPGTQIQVSIHGQQDVFRGFFLQARDAQ-TNEWIGSWYETPNTKTI 113
            :.:|:.|:..|...|....||..|..:....::.:    :|:...:: ..||.| :..|....:|
plant    58 QEKSVDNIDLQSLVSVTNGGPEQQQLILTLAREQI----YLKTETSEDVEEWKG-FILTVIELSI 117

  Fly   114 PEC 116
            |.|
plant   118 PNC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cN-IIIBNP_611895.1 HAD-SF-IE 22..303 CDD:273683 15/68 (22%)
AT2G38680NP_001318374.1 HAD_5NT 54..343 CDD:319807 15/68 (22%)

Return to query results.
Submit another query.