DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cN-IIIB and Nt5c3b

Sequence 1:NP_611895.1 Gene:cN-IIIB FlyBaseID:FBgn0034988 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_017170212.1 Gene:Nt5c3b MGIID:1915356 Length:308 Species:Mus musculus

Alignment Length:285 Identity:115/286 (40%)
Similarity:176/286 (62%) Gaps:3/286 (1%)


  Fly    17 QDIPALTQDHCRMRDPAEVERIINEFVIGGPERMQIVSDFDYTITKQRTEDGGAVPSSFGIFNAC 81
            :.:.:|.:....||.|..|:.|:.....||.:|:|::||||.|::: ...:|...|||..|.:..
Mouse    11 RQVSSLMKATVLMRQPGRVQEIVGALRRGGGDRLQVISDFDMTLSR-FAYNGQRCPSSHNILDNS 74

  Fly    82 QSLPENFKAETDKLYHKYRPIEIDPHMPIAEKVQYMIEWWTKSGELTSGFPFDQSEIDQIASKYT 146
            :.:.|:.:.|..:|:|.|.|||||||..|.||:.:|::||:|:..|.......:.:|.|:..:.|
Mouse    75 KIISEDCRKELTELFHHYYPIEIDPHRTIKEKLPHMVQWWSKAHSLLCQQRIQKVQIAQVVGEST 139

  Fly   147 HALRDRTHEFFADLQRLGIPTLVFSAGLGNSVVSVLRQANVLHPNVKVVSNFLQF-RDGLLDGFQ 210
            ..||:....||..|.:..||..:||||:|:.:..::||..|.|||:.:|||::.| .||.|.||:
Mouse   140 AMLREGYKTFFDTLYQNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFSEDGFLKGFK 204

  Fly   211 QPMIHTFNKNETVLNETSEYYDLVHTRDHIIVMGDSIGDADMASGVPASSHIMKIGFLFDHVEAN 275
            ..:|||:|||.:|. |.|.|:..:..:.:||::||||||..||.|||...:|:|||||.|.||..
Mouse   205 GQLIHTYNKNSSVC-ENSSYFQQLQNKTNIILLGDSIGDLTMADGVPGVQNILKIGFLNDKVEER 268

  Fly   276 MKKYMDTFDIVLVDDQTMDVPRTLL 300
            .::|||::||||..|:|:||...||
Mouse   269 RERYMDSYDIVLEKDETLDVVNGLL 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cN-IIIBNP_611895.1 HAD-SF-IE 22..303 CDD:273683 115/281 (41%)
Nt5c3bXP_017170212.1 UMPH-1 52..297 CDD:283479 101/245 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25497377
eggNOG 1 0.900 E1_KOG3128
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41684
Inparanoid 1 1.050 227 1.000 Inparanoid score I3442
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1171042at2759
OrthoFinder 1 1.000 FOG0002456
OrthoInspector 1 1.000 T617085
orthoMCL 1 0.900 OOG5_130487
Panther 1 1.100 O PTHR13045
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2376
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.