DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cN-IIIB and NT5C3A

Sequence 1:NP_611895.1 Gene:cN-IIIB FlyBaseID:FBgn0034988 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001002010.2 Gene:NT5C3A HGNCID:17820 Length:331 Species:Homo sapiens

Alignment Length:303 Identity:115/304 (38%)
Similarity:188/304 (62%) Gaps:5/304 (2%)


  Fly     3 FDEKREPTGGRLR-LQDIPALTQDHCRMRDPAEVERIINEFVIGGPERMQIVSDFDYTITKQRTE 66
            |..||: ||.:.: ::.:|...:...|:::|..||.||...:.||..::||::|||.|::: .:.
Human    31 FTLKRK-TGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSR-FSY 93

  Fly    67 DGGAVPSSFGIFNACQSLPENFKAETDKLYHKYRPIEIDPHMPIAEKVQYMIEWWTKSGELTSGF 131
            .|...|:...|.:.|:.:.:..:.:..:|..||..||:||.:.:.||..||:||:|||..|....
Human    94 KGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQ 158

  Fly   132 PFDQSEIDQIASKYTHALRDRTHEFFADLQRLGIPTLVFSAGLGNSVVSVLRQANVLHPNVKVVS 196
            ...::::.:|.::....|::....||..||:..||..:||||:|:.:..|:|||.|.||||||||
Human   159 ALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVS 223

  Fly   197 NFLQFRD-GLLDGFQQPMIHTFNKNETVLNETSEYYDLVHTRDHIIVMGDSIGDADMASGVPASS 260
            ||:.|.: |:|.||:..:||.|||::..|..| ||::.:....:||::|||.||..||.||....
Human   224 NFMDFDETGVLKGFKGELIHVFNKHDGALRNT-EYFNQLKDNSNIILLGDSQGDLRMADGVANVE 287

  Fly   261 HIMKIGFLFDHVEANMKKYMDTFDIVLVDDQTMDVPRTLLSLI 303
            ||:|||:|.|.|:..::||||::|||||.|::::|..::|..|
Human   288 HILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKI 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cN-IIIBNP_611895.1 HAD-SF-IE 22..303 CDD:273683 108/282 (38%)
NT5C3ANP_001002010.2 HAD_5NT 59..331 CDD:319807 108/275 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25501789
eggNOG 1 0.900 E1_KOG3128
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1171042at2759
OrthoFinder 1 1.000 FOG0002456
OrthoInspector 1 1.000 T610284
orthoMCL 1 0.900 OOG5_130487
Panther 1 1.100 LDO PTHR13045
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2376
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.