DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cN-IIIB and Y10G11A.1

Sequence 1:NP_611895.1 Gene:cN-IIIB FlyBaseID:FBgn0034988 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001255892.1 Gene:Y10G11A.1 WormBaseID:WBGene00012423 Length:301 Species:Caenorhabditis elegans

Alignment Length:299 Identity:100/300 (33%)
Similarity:159/300 (53%) Gaps:13/300 (4%)


  Fly    12 GRLRLQDIPALTQDHCRMRDPAEVERIINEFVIGGPERMQIVSDFDYTITKQRTEDGGAVPSSFG 76
            |.|:|.::.:|.|.|  ::|...:...:...|.||.:::.::||||:|:::...:.|....|.:.
 Worm     3 GSLKLDELLSLPQVH--VKDIKSLTDKLQNIVSGGADQLMVISDFDFTLSRFADKSGNRCSSCYC 65

  Fly    77 IFNAC--QSLPE---NFKAETDKLYHKYRPIEIDPHMPIAEKVQYMIEWWTKSGELTSGFPFDQS 136
            :|::.  .:.||   .|..    |||||.|||.|..:.|.|||.:|..||.:|..|.....|.:.
 Worm    66 VFDSAVGTNNPEWCRKFVG----LYHKYGPIEHDHSLSIEEKVPFMEAWWQQSHGLIIQGGFKKQ 126

  Fly   137 EIDQIASKYTHALRDRTHEFFADLQRLGIPTLVFSAGLGNSVVSVLR-QANVLHPNVKVVSNFLQ 200
            .||...:.....|||........:....:|.::||||:|..:...|| :...:..|..||||.:.
 Worm   127 AIDDYVAHCNIQLRDNADIMMKKMTNHAVPFIIFSAGIGTIIEMYLRHKFGRVESNTHVVSNMMG 191

  Fly   201 F-RDGLLDGFQQPMIHTFNKNETVLNETSEYYDLVHTRDHIIVMGDSIGDADMASGVPASSHIMK 264
            | .||.::.|..|:||.|.||.:|:.....:.:.:..|.::|::|||:|||.|..||......:|
 Worm   192 FDDDGYVNSFSDPLIHVFCKNSSVMPADRTFSEQIEGRKNVILLGDSVGDAFMDVGVEEEQVSLK 256

  Fly   265 IGFLFDHVEANMKKYMDTFDIVLVDDQTMDVPRTLLSLI 303
            |||:....:..:.||::.|||||||||:||:|..:|..|
 Worm   257 IGFVNHDADKLVDKYLNYFDIVLVDDQSMDIPNQILEAI 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cN-IIIBNP_611895.1 HAD-SF-IE 22..303 CDD:273683 96/288 (33%)
Y10G11A.1NP_001255892.1 UMPH-1 47..296 CDD:283479 86/254 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25495464
eggNOG 1 0.900 E1_KOG3128
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I2749
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1171042at2759
OrthoFinder 1 1.000 FOG0002456
OrthoInspector 1 1.000 T374593
orthoMCL 1 0.900 OOG5_130487
Panther 1 1.100 O PTHR13045
Phylome 1 0.910 0.952 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2376
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.