DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cN-IIIB and nt5c3a

Sequence 1:NP_611895.1 Gene:cN-IIIB FlyBaseID:FBgn0034988 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001120137.1 Gene:nt5c3a XenbaseID:XB-GENE-1004833 Length:286 Species:Xenopus tropicalis

Alignment Length:295 Identity:116/296 (39%)
Similarity:176/296 (59%) Gaps:21/296 (7%)


  Fly    19 IPALTQDHCRMRDPAEVERIINEFVIGGPERMQIVSDFDYTITKQRTEDGGAVPSSFGIFNACQS 83
            :|...:....::||..||.||...:.||..::|:::|||.|::| .:.:|...|:...|.:.|:.
 Frog     2 MPEFQKKSVHIKDPERVEEIICGLIKGGASKLQVITDFDMTLSK-FSHNGKRCPTCHNIIDNCKL 65

  Fly    84 LPENFKAETDKLYHKYRPIEIDPHMPIAEKVQYMIEWWTKSGELTSGFPFDQSEIDQ--IASKYT 146
            :.:..:.:..:|..||..|||||.:.|.||..||:||:|||..|.         |||  ..:|..
 Frog    66 ITDECRKKLFQLKEKYYAIEIDPDLSIKEKYPYMVEWYTKSHTLL---------IDQRLQKNKLA 121

  Fly   147 HALRD------RTHEFFAD-LQRLGIPTLVFSAGLGNSVVSVLRQANVLHPNVKVVSNFLQF-RD 203
            .|:||      ..:|.|.| |.:..||..:||||||:.:..|:.||.|..|||||:|||::| .:
 Frog   122 EAVRDSDVKLKEGYEMFFDLLHKHSIPVFIFSAGLGDILEEVIHQAGVYQPNVKVISNFMEFDEN 186

  Fly   204 GLLDGFQQPMIHTFNKNETVLNETSEYYDLVHTRDHIIVMGDSIGDADMASGVPASSHIMKIGFL 268
            |::.||:..:||.:||::..|..| ||:..:....:||::|||:||..||.|||...:|:|||||
 Frog   187 GIITGFKGELIHVYNKHDGALRNT-EYFAHLKDNSNIILLGDSLGDLTMADGVPNVENILKIGFL 250

  Fly   269 FDHVEANMKKYMDTFDIVLVDDQTMDVPRTLLSLI 303
            .|.||..::||||::|||||.|.|:||..:::..|
 Frog   251 NDKVEELIEKYMDSYDIVLVKDDTLDVANSVIQKI 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cN-IIIBNP_611895.1 HAD-SF-IE 22..303 CDD:273683 114/291 (39%)
nt5c3aNP_001120137.1 UMPH-1 41..286 CDD:283479 103/257 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25500944
eggNOG 1 0.900 E1_KOG3128
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1171042at2759
OrthoFinder 1 1.000 FOG0002456
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2376
TreeFam 1 0.960
87.750

Return to query results.
Submit another query.