DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nop60B and Trub1

Sequence 1:NP_001014547.1 Gene:Nop60B FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_082391.1 Gene:Trub1 MGIID:1919383 Length:338 Species:Mus musculus

Alignment Length:294 Identity:77/295 (26%)
Similarity:115/295 (39%) Gaps:68/295 (23%)


  Fly    87 TGFINLDKPSNPSSHEVV----------------AWIKKILKVEKTGHSGTLDPKVTGCLIVCID 135
            :|...:.||..|:|.|::                .|.|:..:..|.||.||||....|.|:|.|.
Mouse    57 SGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWNKRQKQTLKVGHGGTLDSAAQGVLVVGIG 121

  Fly   136 RATRLVKSQQSAGKEYVAIFKLHGA---VESVAKVRQG--------------LEKLRGALFQRPP 183
            |.|:::.|..|..|.|:.|.:|..|   ::|..||.:.              |:|..|.:.|.||
Mouse   122 RGTKMLTSMLSGSKRYITIGELGKATDTLDSTGKVTEEKPYDKITREDIEGILQKFTGNIMQVPP 186

  Fly   184 LISAVK------------------RQLRVRTVYDSKLLDYDETRNMGVFW---VSCEAGSYIRTM 227
            |.||:|                  |..|..||:...||.:...     |:   |.|..|.|||::
Mouse   187 LYSALKKDGQRLSTLMKKGKVVEARPARPVTVHSISLLKFQPP-----FFTLDVECGGGFYIRSL 246

  Fly   228 CVHLGLVLGVGGQMLELRRVRSGIQSERDGMVTMHDVLDAMWLYENHKDESMLRRVIKPLEGLLV 292
            ...:|..|.....:|||.|.:.|     ...:..|.:.:..|..::  .|..|.|....|...|.
Mouse   247 VSDIGKELSSCASVLELTRTKQG-----PFTLAQHALPEDRWTIDD--IEQSLERCTSLLPEELT 304

  Fly   293 NHKRIIMKDSSVNAVCYGAKITLPGVLRYEDGIE 326
            ..|  :..|:|.:.|.....|||....|.:|.::
Mouse   305 FKK--LKSDNSSDQVISCGYITLRDTKREDDAVK 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330 6/17 (35%)
CBF5 54..379 CDD:273073 77/295 (26%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 62/235 (26%)
PUA 295..368 CDD:279774 9/33 (27%)
Trub1NP_082391.1 PseudoU_synth 58..313 CDD:294089 70/269 (26%)
TruB 58..275 CDD:129523 61/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126700
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.