DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enok and Samd1

DIOPT Version :10

Sequence 1:NP_523838.1 Gene:enok / 37859 FlyBaseID:FBgn0034975 Length:2291 Species:Drosophila melanogaster
Sequence 2:NP_001074884.1 Gene:Samd1 / 666704 MGIID:2142433 Length:519 Species:Mus musculus


Alignment Length:64 Identity:23/64 - (35%)
Similarity:39/64 - (60%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WNQWILEAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAVESGAVIKVYNKGLHSYK 77
            :.:|||:.|..:||:|.||.::|||:.:...|....:....:|||.::..||::|..||..||:
Mouse    31 YQEWILDTIDSLRSRKARPDLERICRMVRRRHGPEPERTRAELEKLIQQRAVLRVSYKGSISYR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enokNP_523838.1 PHD_SF 183..>215 CDD:473978
PHD 248..292 CDD:214584
PLN00104 <714..989 CDD:215056
PspC_subgroup_1 <1171..>1440 CDD:468201
PRK10263 <1206..>1736 CDD:236669
Samd1NP_001074884.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..232 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..381
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..439
SAM_Atherin-like 440..508 CDD:188982
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.