DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap2l and Rap1

Sequence 1:NP_477402.1 Gene:Rap2l FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster

Alignment Length:184 Identity:103/185 (56%)
Similarity:135/185 (73%) Gaps:2/185 (1%)


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:|:||||||||||||||||||...|:|||||||||.|||::|||...|:||||||||||||.
  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            :|||||:|||.||:::||:|...||.|:..::..|.|||.:...|::||.||.||:.:|.|....
  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMN-LTQENRQKK-NYCCCTLL 182
            |..||..::|.|:|.|||.::|||::|..:||::| .:.|.:||| ....|.||
  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCVLL 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 82/149 (55%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 93/162 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120121184
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1353024at2759
OrthoFinder 1 1.000 FOG0000044
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24070
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.