DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chi and SEU

Sequence 1:NP_726403.2 Gene:Chi FlyBaseID:FBgn0013764 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001117434.1 Gene:SEU AraportID:AT1G43850 Length:877 Species:Arabidopsis thaliana

Alignment Length:769 Identity:146/770 (19%)
Similarity:233/770 (30%) Gaps:275/770 (36%)


  Fly    49 GSMLPASNSAVLNPDGSNQSGFAQGGLPYNSAGNPYPP--AGQ------SSPAGNQSIVFQNSN- 104
            |||:....|.. ..|..:..||:  ||...:|.:...|  :||      |:.:.||.:..|..| 
plant    75 GSMISMDTSGA-ESDPMSNVGFS--GLSSFNASSMVSPRSSGQVQGQQFSNVSANQLLAEQQRNK 136

  Fly   105 -------QPG--SNTPQYTSSPAPSGSSTPGPVGAQNIPGNYPQSATAGNFNGPVGGPFGSPSSG 160
                   |.|  .:..|..|:....|.:..|||..:      |...:....:|.|..........
plant   137 KMETQSFQHGQQQSMQQQFSTVRGGGLAGVGPVKME------PGQVSNDQQHGQVQQQQQKMLRN 195

  Fly   161 LGQFS-RPASSGTPFNSGQA---GHFSSPTVF----------SVGGQFNPMPPASPFGHGG---- 207
            ||... .|.......|..|.   ...|..::|          ....||..||..||.....    
plant   196 LGSVKLEPQQIQAMRNLAQVKMEPQHSEQSLFLQQQQRQQQQQQQQQFLQMPGQSPQAQMNIFQQ 260

  Fly   208 --------NHPMMGGPQQMERIDQGFRRHNSYFSHTEHRVFELNK----------RLQQRNEESD 254
                    ...:...|||..::.|.|::.|.........|:|...          |.|.|.|:::
plant   261 QRLMQLQQQQLLKSMPQQRPQLPQQFQQQNLPLRPPLKPVYEPGMGAQRLTQYMYRQQHRPEDNN 325

  Fly   255 NCWWDSFTTEFFEDDARLTILFCLE-DGPKRYTIG-----------------------RTLIPRF 295
            ..:|..|..|:|..:|:..  :|:. .|..|.|.|                       ..::||.
plant   326 IEFWRKFVAEYFAPNAKKR--WCVSMYGSGRQTTGVFPQDVWHCEICNRKPGRGFEATAEVLPRL 388

  Fly   296 FRSIYEGGVSDLYFQLKHAKESFHNTS--ITLDCDQCT--VITQHGKPFFTKVCADARLILEFMY 356
            |:..||.|..:....:...:|| .|:|  |.|:..:.|  .:.:|     .:|..|.:|.:.|..
plant   389 FKIKYESGTLEELLYVDMPRES-QNSSGQIVLEYAKATQESVFEH-----LRVVRDGQLRIVFSP 447

  Fly   357 DDYMRIKSWHMTIKGHRELIPRSVIGTSLPPDPML-------------------LDQITKN---- 398
            |  ::|.||....:.|.|||||.::   :|....|                   |.::..|    
plant   448 D--LKIFSWEFCARRHEELIPRRLL---IPQVSQLGSAAQKYQQAAQNATTDSALPELQNNCNMF 507

  Fly   399 ---------------ITRAGITNSTLNYLRLCVILEPMQELMSRHKAYALSPRDCLKTTLFQKWQ 448
                           :...|.|...:..|::..::..|::|:...:.....|.:.|     .|:.
plant   508 VASARQLAKALEVPLVNDLGYTKRYVRCLQISEVVNSMKDLIDYSRETRTGPIESL-----AKFP 567

  Fly   449 RMVAP----PGKKDPQRPPNKRRKR---------------------------------------- 469
            |...|    || ..||:..::.|::                                        
plant   568 RRTGPSSALPG-PSPQQASDQLRQQQQQQQQQQQQQQQQQQQQQQQQTVSQNTNSDQSSRQVALM 631

  Fly   470 KGSNSGGGN---------------------NS-------------NTPPVTN--QKRSPSG---- 494
            :|:.|.|.|                     ||             |:|...|  |.:|||.    
plant   632 QGNPSNGVNYAFNAASASTSTSSIAGLIHQNSMKGRHQNAAYNPPNSPYGGNSVQMQSPSSSGTM 696

  Fly   495 -PSFSLSSQDVMVVGEPTLMGGEFGEEDERLITRLENTQYDGTNAVEHDNHTGFGHADSP----- 553
             ||.|....::.....||.....            .|...:|..:|.|     .|..:||     
plant   697 VPSSSQQQHNLPTFQSPTSSSNN------------NNPSQNGIPSVNH-----MGSTNSPAMQQA 744

  Fly   554 --ISGSNPWSIDR----------------AGAI--PASPGNGAAPQNNANISDI 587
              :.|:...|:.:                .|::  ..|.||....|.|.|.|.:
plant   745 GEVDGNESSSVQKILNEILMNNQAHNNSSGGSMVGHGSFGNDGKGQANVNSSGV 798

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChiNP_726403.2 LIM_bind 238..440 CDD:280051 55/278 (20%)
SEUNP_001117434.1 LIM_bind 309..563 CDD:280051 52/267 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10378
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.