DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chi and SLK2

Sequence 1:NP_726403.2 Gene:Chi FlyBaseID:FBgn0013764 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001332402.1 Gene:SLK2 AraportID:AT5G62090 Length:816 Species:Arabidopsis thaliana

Alignment Length:742 Identity:136/743 (18%)
Similarity:221/743 (30%) Gaps:298/743 (40%)


  Fly    90 SSPAGNQSIVFQNSNQPGSNTPQY-TSSPAPSGSSTP---GPVGAQNIPGNYPQSATAGNFNGP- 149
            ||.:|   |.||..::..|....: |||...|.:|.|   ||.|     |.:..|..:|:.:.| 
plant     3 SSTSG---IFFQGDDESQSFINSHLTSSYGNSSNSAPGCGGPTG-----GYHNLSMVSGDMHNPV 59

  Fly   150 ---VGGPFGSPSSGLGQFSRPASSGTPFNSGQAGHFSSPTVFSVGGQFNPMPPASPFGHGGNHPM 211
               |..|  .||:|.......|:||.   ||...|.....  |:..:.....||||.....|:..
plant    60 MMSVSTP--GPSAGASSLVTDANSGL---SGGGPHLQRSA--SINNESYMRLPASPMSFSSNNIS 117

  Fly   212 MGG-------------------------------------------------------------- 214
            :.|                                                              
plant   118 ISGSSVVDGSTVVQRHDPSVQLGGSSATSLPTSQTNQIPLSMARRASESFFQDPNNLTQARKKPR 182

  Fly   215 ------------------------PQQMERIDQG-------------FRRHNSYF---------- 232
                                    .||.::..||             .|:...|.          
plant   183 LDSKQDDALQQQILRQWLQRQDILQQQQQQQQQGQNPQFQILLQQQKLRQQQQYLQSLPPLQRVQ 247

  Fly   233 ---------------SHTEH-----------------RVFELN---KRL-------QQRNEESDN 255
                           .|.:.                 |.:|.:   :||       :||..||..
plant   248 LQQQQQVQQQQQLQQQHQQQQQQLQQQGMQMQLTGGPRPYENSVCARRLMQYLYHQRQRPSESSI 312

  Fly   256 CWWDSFTTEFFEDDARLTILFCLED-----------GPKRYT-----------IGR------TLI 292
            .:|..|.||:|...|:..  :||..           .|:..|           .||      .::
plant   313 VYWRKFVTEYFSPRAKKR--WCLSHYDNVGHSALGVSPQAATDEWQCDLCGSKSGRGFEATFDVL 375

  Fly   293 PRFFRSIYEGGVSDLYFQLKHAKESFHNTSITLDCDQCTVITQHGKPFFTKVCADARLI----LE 353
            ||.....:..||.|....|....|..:.:.|        ::.::||.....|....|::    |.
plant   376 PRLNEIKFASGVLDELLYLGVPSERRYGSGI--------MVLEYGKAVQESVYEHIRVVREGHLR 432

  Fly   354 FMYDDYMRIKSWHMTIKGHRELIPRSVIGTSLPPDPMLLD----------------------QIT 396
            .::...::|.||....:.|.||:||.::.   |....||.                      |..
plant   433 IIFSQELKILSWEFCTRRHEELLPRRLVA---PQVNQLLQVAEKCQSTIDQSGSDGIHQQDLQAN 494

  Fly   397 KNITRA-----------------GITNSTLNYLRLCVILEPMQELMSRHKAYALSPRDCLKTTLF 444
            .|:..|                 |.:...:..|::..::..|::::...:...:.|.:.||:..:
plant   495 SNMVMAAGRQLAKSLESHSLNDLGFSKRYVRCLQISEVVSSMKDMIDFCRDQKVGPIEALKSYPY 559

  Fly   445 ---------QKWQRMVAPPGKKDPQRPP--NKRRKRKGSNSGGGNNSNTPPVTNQKRSPSGP--- 495
                     |:.:::.|..|     .||  |...|.....:.|.|    .|:.|.....|.|   
plant   560 RMKAGKPQMQEMEQLAAARG-----LPPDRNSLNKLMALRNSGIN----IPMNNMSGQGSLPGSA 615

  Fly   496 ---SFSLSSQDVMVVGE----PTLMGGEFGEEDERLITRLENTQYDGTNAVEHDNHTGFGHADSP 553
               :|:|::...|::.:    ..|......:|..|  .|..:..|.||:.:    ..||.|:.| 
plant   616 QAAAFALTNYQSMLMKQNHLNSDLNNTTIQQEPSR--NRSASPSYQGTSPL----LPGFVHSPS- 673

  Fly   554 ISG-SNPWSIDRAGAIPASPGNGAAPQ 579
            ||| |:..|..|  .:|:|..||:..|
plant   674 ISGVSSHLSPQR--QMPSSSYNGSTQQ 698

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChiNP_726403.2 LIM_bind 238..440 CDD:280051 52/283 (18%)
SLK2NP_001332402.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10378
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.